SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000012725 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000012725
Domain Number 1 Region: 565-707
Classification Level Classification E-value
Superfamily TPR-like 2.28e-24
Family Tetratricopeptide repeat (TPR) 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000012725   Gene: ENSPCAG00000013582   Transcript: ENSPCAT00000013616
Sequence length 754
Comment pep:novel genescaffold:proCap1:GeneScaffold_5973:3308:69604:1 gene:ENSPCAG00000013582 transcript:ENSPCAT00000013616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDVGGTDQTPAQVGLESVLQPAAKEEQGQLLFHEETIDLGEDEFGSEENETISEDSNNF
IDKLNEQMMESVLISDSPNNSEADVGELGCLQDVTEPRKQSDTGKEETDTLSHDSETNRD
DTPRDVSDMTTDSRVSLKEEPACLASGEEAADSEQISEVSSSQSSSKDEPVPVCTIFSQR
PNQFPASHDGFESQMVKSPSFSSTSESSAKTPPQMVQPSPSLSKFFADTTTANSLASDFF
DSFTTSTFISVSNPNAGPSAPEKLSSLTTAGTDKSPDPIARDRWIQATASLEISQSPKPF
SQIQAVFAGSDDPFATALNISEMDKNDAWLPSEGTRNILISVATQQYSTVFVDKDNLTMP
GLKFDNVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXSMVPFSMRILHAELQQYLGNPQEALDRLHRMKAICSRILTNLEQGLAE
DGGMSNITQENRQASLQLWRSRLGRVMYSMANCLLMMKDYVLAVEAYHSVIRYYPEQEPQ
LLSGIGRIFLQIGDIRTAEKYFQDVEKVTQKLDGLQGKIMVLMNRAFLYLGQNNFAEAHK
FFTEIVRIEPRNAVANNNAAVCLLYLGRLKDSLRQLEAMVQQDPQHCLHESVLFNLTTMY
ELESSRSMQKKQSLLEAVAVKEGDSFNTQCLKLA
Download sequence
Identical sequences ENSPCAP00000012725 ENSPCAP00000012725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]