SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000012751 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000012751
Domain Number 1 Region: 192-313
Classification Level Classification E-value
Superfamily TPR-like 1e-25
Family Tetratricopeptide repeat (TPR) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000012751   Gene: ENSPCAG00000013669   Transcript: ENSPCAT00000013642
Sequence length 329
Comment pep:novel scaffold:proCap1:scaffold_9164:22062:46728:-1 gene:ENSPCAG00000013669 transcript:ENSPCAT00000013642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DKEMMQRIREKSILKAQEMAKEAAEAKAAAKREAQKYALSVVMEIEEKERKKIEDLKENE
RRKATEELEAWKEHQQKAEKQEKPQKEEKSRPQEQQIEERKKIKKKKCLTRSVASRDHTT
KGRNSENMFCEPVTAASLPPPRPGGTVAVSFTPRAFPTALRESRTAEEEEWLHRQAEARR
AGSADVPELHDLKEDERDPEWLKDKGNKLFATENYLAAVNAYSLALRLNSRMPVLYLNRA
ACHLKLRNLHKAIEDSSKALELLTPPVADNASARVKAHVRRGTAFCQLELYAEGLLDYEA
ALKIEPSNKTVQNDAEKIRNIIQGTELKS
Download sequence
Identical sequences ENSPCAP00000012751 ENSPCAP00000012751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]