SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000013691 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000013691
Domain Number 1 Region: 102-165
Classification Level Classification E-value
Superfamily TPR-like 0.000000000464
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000013691   Gene: ENSPCAG00000014696   Transcript: ENSPCAT00000014650
Sequence length 183
Comment pep:novel genescaffold:proCap1:GeneScaffold_2070:2152:34300:-1 gene:ENSPCAG00000014696 transcript:ENSPCAT00000014650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASFGWKRKIGEKVSKVTSQQFEAEAADEKDVAENNEGNWLHAIKRRKEMLVEGCAEKSK
QLKDEGASLAENKXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLMSLHEMFPAVHAAEMAV
QRNPHSWESWQTLGRAQLGLGEIVLAIRSFQVALHIYPMNPELWNEDLSWARTLQEQQKV
AQR
Download sequence
Identical sequences ENSPCAP00000013691 ENSPCAP00000013691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]