SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000013882 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000013882
Domain Number 1 Region: 431-673
Classification Level Classification E-value
Superfamily TPR-like 3.79e-40
Family Tetratricopeptide repeat (TPR) 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000013882   Gene: ENSPCAG00000014827   Transcript: ENSPCAT00000014856
Sequence length 688
Comment pep:novel genescaffold:proCap1:GeneScaffold_2719:2121:67936:-1 gene:ENSPCAG00000014827 transcript:ENSPCAT00000014856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLQAETPLGDLWHHDFWGSKLSSNTSHKSYRPLTVLTFRMNYYLSGGFHPVGFFVINILL
HSGVSVLMVDVFSVLFGGLQYTSKGRRLNLAPRASLLAALLFAVHPVHTECVAGVVGRAD
LLCALFFVLSFLGYCKAFRESSKEGTHASTSWVVLSILLGAVAMLCKEQGITVLGLNAVF
DILVIGKLNILEIVQKILQKDKSLENFGVLRNGGLLLRMTLLALGGAVMLYVRWKIMGTG
PPAFTEVDNPASFANSVLVRAINYNYYYSLNAWLLLCPWWLCFDWSMGCIPLIKSVRDWR
IIALVALWFCLIGLICQALCSEDSHKRRILTLGLGFLIIPFLPASNLFFRVGFVVAERVL
YLPSVGYCVLLTFGFGALSKHMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXVHYNVGKNLADGGNHTAAIRYYREAVRLNPKYVHAMNNLGNILKERNELQ
EAEELLSLAVQIQPDFAAAWMNLGIVQNSLKQFEAAEQSYRTAIRHRRKYPDCYYNLGRL
YADLNRHMDALSAWRNATVLKPEHSLAWNNMIILLDNTGNLAQAEAVGREALELIPDDHS
LMFSLANVLGKSQKYKESEALFLKAIKANPSAASYHGNLAVLYHRWGHLDLAEKHYEISL
QLDPTAPGTKENYGLLRRKLVQLQKKDV
Download sequence
Identical sequences ENSPCAP00000013882 ENSPCAP00000013882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]