SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000013925 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000013925
Domain Number 1 Region: 310-624
Classification Level Classification E-value
Superfamily TPR-like 1.67e-110
Family Tetratricopeptide repeat (TPR) 0.0000000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000013925   Gene: ENSPCAG00000014897   Transcript: ENSPCAT00000014899
Sequence length 626
Comment pep:novel genescaffold:proCap1:GeneScaffold_419:89762:223831:-1 gene:ENSPCAG00000014897 transcript:ENSPCAT00000014899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYQGHMQKSKEKGYGKLSSDEDLEIIVDHKEGKGSRAADKAVAMVMKEIPREESAEEKPL
LTMTSQLVNEQQESRPLLSPSIDDFLCEAKSEAAARPVTSNTAVLTTGLDLLDLSEPVSQ
TQTKAKKLEASSKTSSLKKKADGSDLMNADTEQTGQPLRVAETASLDLDIHTQLEKWDDV
KFHGEQTSKGLPAAERKSCSSGAGSKELLWSSEHRSQPEPSSGKSTLNSEPASELGIVAP
SQARLTKEQRWGGALLSRNHSLEEEFERAKAAVESDTEFWDKMQAEWEEMARRNWISENQ
EAQNQVTISASEKGYYFHTENPFKDWPGAFEEGLKRLKEGDLPVTILFMEAAILQDPGDA
EAWQFLGITQAENENEQAAIVALQRCLELQPSNLKALMALAVSYTNTGHQQDACDALKNW
IKQNPKYKYLVKSKKGSPGLSRRMSKTPVDSSVLEGVKELYLEAAHQNGDLIDPDLQTGL
GVLFHLSGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPG
FIRSRYNLGISCINLGAYREAVSNFLTALSLQRKSRNQQQVPHPAISGNIWAALRIALSL
MDRPELFQAANLGDLDVLLRAFNLDP
Download sequence
Identical sequences ENSPCAP00000013925 ENSPCAP00000013925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]