SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000015350 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000015350
Domain Number 1 Region: 860-1069
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-54
Family DBL homology domain (DH-domain) 0.00027
Further Details:      
 
Domain Number 2 Region: 1058-1178
Classification Level Classification E-value
Superfamily PH domain-like 1.06e-23
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 3 Region: 1232-1418
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-22
Family Pleckstrin-homology domain (PH domain) 0.0000059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000015350   Gene: ENSPCAG00000016370   Transcript: ENSPCAT00000016397
Sequence length 1422
Comment pep:novel genescaffold:proCap1:GeneScaffold_6429:8880:160809:-1 gene:ENSPCAG00000016370 transcript:ENSPCAT00000016397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSAAEIKKPPVAPKPKFVMANNKLSPPPVAPKPETVISSATQSTRKTKPAIAPKPKVLR
DSPVRDIRLSPSKKNTVNLEEHKQKASENADDFSCKNVGDQSSDYILPVCSCHSECIHKL
GNRGNLCVKQLVLEPLEMHENLENSKIDKFSLTIKTGNKCDSHGEKVKSQSGVVLKASIL
EETLKDVLTEGMSPFSSPQKHRSTDNLEMNGGCNSNKQFRIEITDLSQSSSSFEKIPDHH
HLLQPLNDEFQIAETCQDSSRKNSSCFHSSKEEALENEDGVSKLTEVKDLGALEIHLIPY
TKKFPTPKPRKTRTARLIRQKYVDASSESTEEPGNSDSSSSFLTEDNLKNDDILYQNVLC
NLEQVDKVQEGSKDESNRDSDCDTQDFANSQKAVCPETSLFEKMVPPLDKDSNLSPDKTE
DDCTMSLPVDNGTSIVRCNTLSMSLPKQLKLSCNEHLPIAYNLGICASQVQKESTVKDQS
SSRIIPKKPQRHSLPAAGVLKKAASVELVETSSYPTNEEKNSEKSLEGNHVQHLCAPNHG
MSSSFDTPKRVSEKPVWKLPHPILPFSGHPESLKSMKMSSNSEPSSVLTKPRAKSLSAVD
VEKSAKPCKDSQKKNSLKKLLNVKLSICFMKSDFQKFWSKSSQLGDMTTSNRCGEERKGV
ENDWHGLLTGDKKRSKPTKAYSADNYSLESQKKRKKSRGQTSMTSSPRAESLDDQLLSRQ
SSFQAPCKSVTSTCAPEYENIHHYKEMPEYENLPFIMVIGKTPEFECHNSSTMEDTDTSV
YEIEDPYEAPASPLQLGPRLHHCSSGASQEGHSSLDLGLDDLPSDEEEVINSSDEDDVSS
GSSKGEPDPLEDKQGEDTGLHCKVHLIAKEIMSSEKVFVDVLKLLHIDFRDAVAHASRQL
GKPVIEDRILNQILYYLPQLYELNRDLLKELEERMLNWTEQQRIADIFVKKGPYLKMYST
YIKEFDKNIALLDEQCKKNPGFAAAVREFEMSPRCANLALKHYLLKPVQRIPQYRLLLTD
YLKNLVEDSGDYRDTQDALAVVIEVANHANDSMKQGDNFQKLMQIQYSLNGHHEIVQPGR
VFLKEGTLMKLSRKVMQPRMFFLFNDALLYATPVPSGMFKLNNMLSLAGMKVRKPTQEAY
QNELKIESVERSFILSAGSATERDEWLEAISKSIEEYAKKRITFCPSRSLEQADLENNEE
VCPLGSKAPIWVPDTRVTMCMICTSEFTLTWRRHHCRACGKIVCQACSSNKYGLDYLKNQ
PARVCEHCFQELQKLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVS
ANTEDSSMSGYLYRSKGNKKPWKHLWFVIKNKVLYTYAASEDVAALESQPLLGFTVTQVR
DENSESKVFQLLHKNMLFYIFKAEDAHSAQKWIEAFQEGTIL
Download sequence
Identical sequences ENSPCAP00000015350 ENSPCAP00000015350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]