SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000015520 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000015520
Domain Number 1 Region: 403-532
Classification Level Classification E-value
Superfamily TPR-like 0.000000000119
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000015520
Domain Number - Region: 312-388
Classification Level Classification E-value
Superfamily TPR-like 0.0607
Family CT2138-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000015520   Gene: ENSPCAG00000016578   Transcript: ENSPCAT00000016580
Sequence length 585
Comment pep:novel genescaffold:proCap1:GeneScaffold_461:10072:53689:-1 gene:ENSPCAG00000016578 transcript:ENSPCAT00000016580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVELEWIPETLYNTAISAVVDNYTRSRRDIRSLPENIQFDVYYKLYQQGRLCQLGSEF
CELEVFAKVLRALDKRHLLHHCFQALMDHGVKVASVLAYSFSRRCSYIAESDAAVKEKAI
QVGFVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFRAVECCVRLLHVRNGNCKYH
LGEETFKLAQTFMDKLSKHGQQANKAALYGELCALLFAKSHYDEXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXQAALDIRQSVFGGKNIHVATAHEDLAYSSYVHQYSSGKFDNALFHAERA
IGIITHILPEDHLLLASSKRVKALILEEIAIDCHNKETEQRLLQEAHDLHLSSLQLAKKA
FGEFNVQTAKHYGNLGRLYQSMRKFKEAEEMHIKAIQIKEQLLGQEDYEVALSVGHLASL
YNYDMNQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVL
SNWNRLRDRQYSVTDALEDVNTSPQSTEEVVKSFLISQNTEGPSC
Download sequence
Identical sequences ENSPCAP00000015520 ENSPCAP00000015520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]