SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000015802 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000015802
Domain Number 1 Region: 305-405
Classification Level Classification E-value
Superfamily TPR-like 3.16e-25
Family Tetratricopeptide repeat (TPR) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000015802   Gene: ENSPCAG00000016882   Transcript: ENSPCAT00000016886
Sequence length 519
Comment pep:novel genescaffold:proCap1:GeneScaffold_4894:80055:86625:1 gene:ENSPCAG00000016882 transcript:ENSPCAT00000016886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPIPKTAGRIELDCPLRSGFPLGVAAVPKLCQEFGPEDYGDEDLVDFLRRLVQTDAPGL
HRIHVDESSRRLQLWHHDDLLNHLHDEEKTARQRDGGRGAEGPGTYCGLRKSFLSPSWES
RPCPQSQCASASSPSDSDSLRQVVMPQRRLVTAEEANRLAEELVAEEERGKQKAEKRRLK
KKRQKERKLRARSEQHGGEAAAKATPSGDRSPPCSPGNPAPGQCGEEADSLDLSSTFVFL
ALRKVRDRPSGVPTNKGLSQEPQLRHQGPQQEGHLREERPPREEQPRQSPEAEVSPGLLA
AALQKSQELAELGNNFARKGLYQEAVVCFTQALKLNPRDHRLFGNRSFCHERLGQLVWAL
ADAQVALTLCPGWPRGLFRLGKALMGLQRFEEAAAVFQETLRGGSQPDAAWELHACLLQL
QDRRGGVSVPPPPPGFPQPPPRAGLGVPGPLSLSRPRIMAPRAPGLPLPPSRHPPPHVGH
QNWPWPQAPRRGPRPLHLHHPSKDEGPLGLGCQRLPQAR
Download sequence
Identical sequences ENSPCAP00000015802 ENSPCAP00000015802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]