SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|451943475|ref|YP_007464111.1| from Corynebacterium halotolerans YIM 70093 = DSM 44683

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|451943475|ref|YP_007464111.1|
Domain Number 1 Region: 59-325
Classification Level Classification E-value
Superfamily SIS domain 1.6e-32
Family mono-SIS domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|451943475|ref|YP_007464111.1|
Sequence length 329
Comment hypothetical protein A605_03690 [Corynebacterium halotolerans YIM 70093 = DSM 44683]
Sequence
MDNSYLDGSGYDRETVAFYDVAHEGAQVRTVAGVLDQLAGLYGLNPRSVVVLPTDQVSHA
AARFVTAVRSPLRLPVVVTDTLPGYVGALDVVIAVGDRGEDPELSQALLTAARRGAVTIL
AGPAQGPILEDAPDDCVIVPASPTAVGPSPSRAITVVGTVLDLLEEDPDLVGQRLQEVAD
AVDAELEQLSPERDELVNPGRQLRAFVEGARVLHTGRSRLGRALAEIVATIWSTKGLPSG
FVEADELGTALAAGPAAPAADDIFHDPYLDGPAVVLPLKTIVWAEEEAGLAHSLAVHCES
PGLGDSASALKLITRGFAATAYEARVEEI
Download sequence
Identical sequences M1MVJ4
WP_015400168.1.78411 WP_015400168.1.94491 gi|451943475|ref|YP_007464111.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]