SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000000511 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000000511
Domain Number 1 Region: 284-414
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.36e-44
Family Regulator of G-protein signaling, RGS 0.00000355
Further Details:      
 
Domain Number 2 Region: 9-111
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.96e-27
Family DEP domain 0.0052
Further Details:      
 
Domain Number 3 Region: 213-273
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 4.45e-17
Family Transducin (heterotrimeric G protein), gamma chain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000000511   Gene: ENSPVAG00000000545   Transcript: ENSPVAT00000000544
Sequence length 464
Comment pep:novel genescaffold:pteVam1:GeneScaffold_2552:174627:183452:-1 gene:ENSPVAG00000000545 transcript:ENSPVAT00000000544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGRRPGAQMPHLSKMERVVVSMQDPDQGVKVRSQRLLITVVPHAVTGNDIMEWLIQKY
CISEEEALHLGILLVRHGYLYPLREPRSLVLRPDETLYRFQTPYFWTSTLWPAAELDYAI
YLAKKNIRKQGALADHEKEHYDQLHRKINHTWDLVVMQAREQLRAAKQRRKGDRLVIACQ
EQTYWLVNRPPXXXXXXXXXXXXXXXXXXXXXXXTKNTDFYKREVEFCRKALGRTRVKSS
VCLEAYLKFSSQHEPHDPIMSGCLPSNPWITDDDYWAMNAPSVAAPTKLRVEQWGFSFRE
LLEDPMGRAHFMDFLRKEFSAENLSFWEACEELRHGRQAQVPTLVDTVYQQFLAPGAARW
VNIDSQTMERTLEGLHQPHRYMLDDAQLHIYMLMKKDSYPRFLKSEMYKALLEEAVIPSE
TKRRVFPFMRKPRRSSPSPALLLASASGETAAAAGGPSSGDGEA
Download sequence
Identical sequences ENSPVAP00000000511 ENSPVAP00000000511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]