SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000001817 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000001817
Domain Number 1 Region: 80-185
Classification Level Classification E-value
Superfamily Glutaminase/Asparaginase 6.02e-36
Family Glutaminase/Asparaginase 0.0000545
Further Details:      
 
Domain Number 2 Region: 265-377
Classification Level Classification E-value
Superfamily Glutaminase/Asparaginase 7.07e-24
Family Glutaminase/Asparaginase 0.0000732
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000001817
Domain Number - Region: 409-450
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0663
Family Ankyrin repeat 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000001817   Gene: ENSPVAG00000001925   Transcript: ENSPVAT00000001924
Sequence length 450
Comment pep:novel genescaffold:pteVam1:GeneScaffold_2809:16958:29431:1 gene:ENSPVAG00000001925 transcript:ENSPVAT00000001924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEPSLSLRAGVGRLPGAAVGRPSGARLCSWGRQVEGMPGSVRRMRRVCGVGPGHWAPGCG
RGEQGWPMGALSGSPFCLLQPPMNQRVIYTVLECQPLFDSSDMTITEWVQIAQTIETHYE
QYHGFVILHGTDTMAFAASALAFVLENLQKTVILTGSQVPIHALWSDGRENLLGALLMAG
QYVIPEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXVRAFLQPPLKGVVTETFGSGNGPTKPDLLQELRA
AAERGLIILNCTHCLQGSVTSHYAAGMAAAGAGIVSGFDVTSEAALAKLSYVLGRPGLSV
DGRKELLARDLRGEMTLPAVDEGPPPLCGSTLRLGVAQFLSLSQESDAVRDTLTPSLACA
AARAGDLQLAELGTDLSLEDFNGQTPLHAA
Download sequence
Identical sequences ENSPVAP00000001817 ENSPVAP00000001817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]