SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000003284 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000003284
Domain Number 1 Region: 7-69
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 1.2e-21
Family Transducin (heterotrimeric G protein), gamma chain 0.000096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000003284   Gene: ENSPVAG00000003474   Transcript: ENSPVAT00000003474
Sequence length 75
Comment pep:novel genescaffold:pteVam1:GeneScaffold_3594:125410:125909:1 gene:ENSPVAG00000003474 transcript:ENSPVAT00000003474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPT
SENPFREKKFFCALL
Download sequence
Identical sequences A0A091DGM0 A0A0D9R2Z5 A0A0P6JG17 A0A1S3G8V9 A0A1U7QDI2 A0A1U7TDE5 A0A286XAH1 A0A287BSK8 A0A2I2ULW5 A0A2I3LX31 A0A2K5DN96 A0A2K5HLC5 A0A2K5N1U8 A0A2K5R8K3 A0A2K5ZPQ5 A0A2K6DIZ0 A0A2K6FFJ7 A0A2K6LRI2 A0A2K6QDH2 A0A2K6S749 D2HS78 F7CFD7 F7I3K5 G1QVF4 G1SXA0 G3II34 G3QL06 G3SW43 G3V8K2 G7NCS9 G7PPT4 H0XZA2 H2ND45 H2Q3W7 I3LXV3 L5KR54 L8I0K3 P63214 P63215 P63216 U6CVX2 W5Q598
ENSAMEP00000006800 ENSOARP00000017888 ENSMUSP00000093978 ENSBTAP00000003257 ENSLAFP00000004505 ENSPCAP00000009369 ENSPPYP00000003639 ENSTSYP00000011504 ENSCJAP00000034785 ENSP00000294117 ENSDORP00000008145 ENSMICP00000009046 ENSFCAP00000005879 ENSOGAP00000021445 ENSOCUP00000008163 ENSSARP00000007871 ENSCJAP00000034785 ENSPTRP00000006503 ENSCPOP00000018171 ENSMICP00000009046 ENSCPOP00000018171 10090.ENSMUSP00000093978 10116.ENSRNOP00000026539 10141.ENSCPOP00000018171 9598.ENSPTRP00000006503 9600.ENSPPYP00000003639 9606.ENSP00000294117 9615.ENSCAFP00000023072 9685.ENSFCAP00000005879 9796.ENSECAP00000017596 9913.ENSBTAP00000003257 9986.ENSOCUP00000008163 ENSP00000294117 ENSPPYP00000003639 ENSECAP00000017596 NP_001254715.1.72884 NP_034446.1.92730 NP_036334.1.87134 NP_036334.1.92137 NP_446110.1.100692 NP_446110.1.4139 NP_776498.1.59421 NP_776498.1.76553 XP_001156854.1.37143 XP_002721046.1.1745 XP_002755480.1.60252 XP_002821694.1.23681 XP_003274140.1.23891 XP_003419690.1.64505 XP_003467965.1.53824 XP_003514351.1.69978 XP_003798764.1.62490 XP_003828547.1.60992 XP_003993574.1.62641 XP_004051413.1.27298 XP_004264275.1.21590 XP_004383895.1.4749 XP_004413833.1.74151 XP_004437549.1.5094 XP_004621569.1.94378 XP_004646766.1.9945 XP_004656616.1.11716 XP_004682769.1.23501 XP_004874451.1.39548 XP_005063924.1.91757 XP_005331537.1.77405 XP_005351968.1.66349 XP_005414835.1.28644 XP_005577627.1.63531 XP_005904904.1.15283 XP_005966852.1.78601 XP_006064603.1.26621 XP_006064604.1.26621 XP_006181835.1.101512 XP_006214907.1.17985 XP_006718563.1.92137 XP_006730410.1.47382 XP_006875082.1.41390 XP_006899879.1.29581 XP_006911257.1.64745 XP_006995250.1.50099 XP_007092014.1.5354 XP_007110022.1.24612 XP_007110023.1.24612 XP_007462199.1.90284 XP_007608226.1.28591 XP_007943061.1.48129 XP_007993527.1.81039 XP_008051796.1.4292 XP_008530405.1.77740 XP_008530406.1.77740 XP_008530407.1.77740 XP_008530408.1.77740 XP_008571717.1.73410 XP_008705738.1.72690 XP_008835736.1.79516 XP_010334044.1.74449 XP_010334048.1.74449 XP_010383177.1.97406 XP_010631280.1.5607 XP_010631281.1.5607 XP_010852307.1.44457 XP_010852308.1.44457 XP_010954742.1.22495 XP_010954743.1.22495 XP_010981314.1.51371 XP_010981315.1.51371 XP_011366955.1.92234 XP_011718770.1.29376 XP_011718771.1.29376 XP_011718772.1.29376 XP_011848779.1.47321 XP_011897438.1.92194 XP_012394007.1.21590 XP_012520653.1.63892 XP_012633668.1.48125 XP_012884688.1.60039 XP_012884689.1.60039 XP_013203399.1.66349 XP_013365511.1.28644 XP_013365512.1.28644 XP_013849659.1.46622 XP_014585114.1.31192 XP_014585115.1.31192 XP_014689824.1.49734 XP_014689826.1.49734 XP_014689827.1.49734 XP_014689828.1.49734 XP_014689829.1.49734 XP_014935352.1.86478 XP_014935353.1.86478 XP_015333588.1.40921 XP_015844181.1.50099 XP_017359438.1.71028 XP_017359439.1.71028 XP_017510074.1.32401 XP_017733848.1.44346 XP_017833697.1.60252 XP_017898479.1.57651 XP_019270245.1.44245 XP_019270246.1.44245 XP_019500830.1.44202 XP_019569474.1.88060 XP_019661656.1.58354 XP_019668119.1.62641 XP_019788151.1.83887 XP_019788152.1.83887 XP_019810228.1.53367 XP_020755215.1.74333 XP_021063758.1.100879 XP_021507528.1.76796 XP_021540609.1.83697 XP_540904.2.84170 ENSP00000294117 ENSSTOP00000000936 ENSOGAP00000021445 ENSVPAP00000005036 ENSDORP00000008145 ENSTTRP00000002318 ENSPVAP00000003284 ENSRNOP00000026539 ENSGGOP00000003144 ENSECAP00000017596 gi|6912394|ref|NP_036334.1| ENSNLEP00000004925 ENSSARP00000007871 ENSBTAP00000003257 ENSOCUP00000008163 ENSSTOP00000000936 ENSLAFP00000004505 ENSTSYP00000011504 ENSMUSP00000093978 ENSTTRP00000002318 ENSPVAP00000003284 ENSPCAP00000009369 ENSAMEP00000006800 ENSNLEP00000004925 ENSPTRP00000006503 ENSRNOP00000026539 ENSGGOP00000003144 ENSMUSP00000093978 ENSPANP00000005346 ENSVPAP00000005036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]