SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000003529 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000003529
Domain Number 1 Region: 4-62
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 6.8e-21
Family Transducin (heterotrimeric G protein), gamma chain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000003529   Gene: ENSPVAG00000003731   Transcript: ENSPVAT00000003730
Sequence length 68
Comment pep:novel genescaffold:pteVam1:GeneScaffold_1743:119829:123580:-1 gene:ENSPVAG00000003731 transcript:ENSPVAT00000003730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSSSVTAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFR
PQKVCSFL
Download sequence
Identical sequences G1PTP3
XP_006086207.1.53796 XP_006759727.1.95426 XP_006919423.1.64745 XP_008137696.1.99482 XP_011353868.1.92234 XP_014309063.1.53796 XP_016076138.1.3490 XP_019570789.1.88060 ENSPVAP00000003529 ENSMLUP00000014606 ENSPVAP00000003529 ENSMLUP00000014606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]