SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000012360 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000012360
Domain Number 1 Region: 3-62
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 1.22e-17
Family Transducin (heterotrimeric G protein), gamma chain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000012360   Gene: ENSPVAG00000013107   Transcript: ENSPVAT00000013107
Sequence length 67
Comment pep:novel genescaffold:pteVam1:GeneScaffold_3087:138832:139204:-1 gene:ENSPVAG00000013107 transcript:ENSPVAT00000013107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEWDVPQMKKEVESLKYQLAFKREMSSKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVE
KGKCSIL
Download sequence
Identical sequences L5KGN2
ENSPVAP00000012360 ENSPVAP00000012360 XP_007955659.1.48129 XP_015992150.1.101085 XP_015992151.1.101085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]