SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000012629 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000012629
Domain Number 1 Region: 4-65
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 2.42e-23
Family Transducin (heterotrimeric G protein), gamma chain 0.0000413
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000012629   Gene: ENSPVAG00000013390   Transcript: ENSPVAT00000013390
Sequence length 71
Comment pep:novel scaffold:pteVam1:scaffold_386:128534:144423:1 gene:ENSPVAG00000013390 transcript:ENSPVAT00000013390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENP
FREKKFFCAIL
Download sequence
Identical sequences A0A091G022 A0A0D9RRD8 A0A1S3EWK9 A0A1S3WMS4 A0A1U7RGQ0 A0A1U7UJ28 A0A1U8CT66 A0A286XGV0 A0A2I2U993 A0A2J8WKN5 A0A2K6TVG1 D2HV45 F6PY28 F6RVK5 G1NX68 G1T7V6 G3IAE2 G3SRT2 G5BLN9 G7MXW9 G7PA91 H0WUG8 H2Q8A8 H3B8Z9 I3LJ42 I3MSM6 K7FS23 L5K3D3 L8ILN3 L9J8X7 P59768 P63212 P63213 Q5R7U4 Q6DF43 S9WKG8 W5QHP9
ENSBTAP00000003959 ENSOARP00000022249 ENSCJAP00000012806 ENSLACP00000018370 ENSNLEP00000015057 ENSMUSP00000055256 ENSTTRP00000005402 ENSLACP00000018370 ENSMLUP00000001955 gi|49900175|gb|AAH76900| gi|52345982|ref|NP_001005038| ENSP00000334448 ENSP00000451102 ENSP00000451231 ENSP00000451576 ENSP00000452014 ENSP00000484021 10090.ENSMUSP00000055256 8364.ENSXETP00000035970 9544.ENSMMUP00000013618 9598.ENSPTRP00000010751 9600.ENSPPYP00000006605 9606.ENSP00000334448 9615.ENSCAFP00000021588 9796.ENSECAP00000010301 9823.ENSSSCP00000005406 9913.ENSBTAP00000003959 9986.ENSOCUP00000012613 ENSMMUP00000013618 2qnsB ENSVPAP00000010654 ENSVPAP00000010654 ENSPVAP00000012629 ENSTSYP00000007348 ENSPTRP00000010751 ENSXETP00000035970 HGL_H00000334448 ENSDORP00000011590 ENSPCAP00000000371 ENSECAP00000010301 ENSDORP00000011590 ENSAMEP00000002219 ENSOGAP00000005871 ENSMUSP00000055256 NP_001005038.1.99540 NP_001033726.1.92730 NP_001177839.1.72884 NP_001230702.1.87134 NP_001230702.1.92137 NP_001230703.1.87134 NP_001230703.1.92137 NP_001272837.1.92730 NP_001272838.1.92730 NP_001272839.1.92730 NP_001272840.1.92730 NP_034445.1.92730 NP_444292.1.87134 NP_444292.1.92137 NP_776497.1.59421 NP_776497.1.76553 XP_001158320.1.37143 XP_001158380.1.37143 XP_003267733.1.23891 XP_003267734.1.23891 XP_003408653.1.64505 XP_003471873.1.53824 XP_003511975.1.69978 XP_004087183.1.23891 XP_004370919.1.4749 XP_004408106.1.74151 XP_004436392.1.5094 XP_004454142.1.11602 XP_004454143.1.11602 XP_004584877.1.84141 XP_004638808.1.9945 XP_004649238.1.11716 XP_004681928.1.23501 XP_004835596.1.39548 XP_005004596.1.53824 XP_005083627.1.91757 XP_005211711.1.76553 XP_005290275.1.60341 XP_005290276.1.60341 XP_005290277.1.60341 XP_005322910.1.77405 XP_005367661.1.66349 XP_005376845.1.28644 XP_005561309.1.63531 XP_005603524.1.31192 XP_005603525.1.31192 XP_005603526.1.31192 XP_005623455.1.84170 XP_005623456.1.84170 XP_005685709.1.57651 XP_005685710.1.57651 XP_005685711.1.57651 XP_005867947.1.60319 XP_005894607.1.15283 XP_005955085.1.78601 XP_005996045.1.90931 XP_005996046.1.90931 XP_006023153.1.24877 XP_006023155.1.24877 XP_006046402.1.26621 XP_006046403.1.26621 XP_006046404.1.26621 XP_006106545.1.53796 XP_006160599.1.99106 XP_006160600.1.99106 XP_006272682.2.47583 XP_006720236.1.92137 XP_006746757.1.47382 XP_006773850.1.95426 XP_006920253.1.64745 XP_006920254.1.64745 XP_006920255.1.64745 XP_006998029.1.50099 XP_007069368.1.26238 XP_007115828.1.24612 XP_007192917.1.59432 XP_007192918.1.59432 XP_007446015.1.90284 XP_007621621.1.28591 XP_007984876.1.81039 XP_007984877.1.81039 XP_007984879.1.81039 XP_007984880.1.81039 XP_008068702.1.4292 XP_008068703.1.4292 XP_008137275.1.99482 XP_008267873.1.1745 XP_008699761.1.72690 XP_008699770.1.72690 XP_008837802.1.79516 XP_008955320.1.60992 XP_008955321.1.60992 XP_009247325.1.23681 XP_009557077.1.62272 XP_010339382.1.74449 XP_010630862.1.5607 XP_010630863.1.5607 XP_010630864.1.5607 XP_010807541.1.76553 XP_010840571.1.44457 XP_010840572.1.44457 XP_010840573.1.44457 XP_010840574.1.44457 XP_011232208.1.58354 XP_011281536.1.62641 XP_011383811.1.92234 XP_011383819.1.92234 XP_011535148.1.92137 XP_011739879.1.29376 XP_011739880.1.29376 XP_011739881.1.29376 XP_011817178.1.43180 XP_011817179.1.43180 XP_011817180.1.43180 XP_011817181.1.43180 XP_011817183.1.43180 XP_011817184.1.43180 XP_011817185.1.43180 XP_011855120.1.47321 XP_011855121.1.47321 XP_011855122.1.47321 XP_011855123.1.47321 XP_011855124.1.47321 XP_011855125.1.47321 XP_011917199.1.92194 XP_011917200.1.92194 XP_012306477.1.9421 XP_012306480.1.9421 XP_012359909.1.23891 XP_012519265.1.63892 XP_012519266.1.63892 XP_012867811.1.60039 XP_012867812.1.60039 XP_012978634.1.91757 XP_013010146.1.53824 XP_013365782.1.28644 XP_014203062.1.60992 XP_014333346.1.15283 XP_014425597.1.96668 XP_014450620.1.47583 XP_014709721.1.49734 XP_014709722.1.49734 XP_014709723.1.49734 XP_014935617.1.86478 XP_014935618.1.86478 XP_014999125.1.72884 XP_014999126.1.72884 XP_014999127.1.72884 XP_015309270.1.63531 XP_015309271.1.63531 XP_015399971.1.5354 XP_015976282.1.101085 XP_015976283.1.101085 XP_016047592.1.11023 XP_016053598.1.3490 XP_016781570.1.37143 XP_016781571.1.37143 XP_016781572.1.37143 XP_016781573.1.37143 XP_016876865.1.92137 XP_016876866.1.92137 XP_017203785.1.1745 XP_017203786.1.1745 XP_017499957.1.32401 XP_017705014.1.44346 XP_017705015.1.44346 XP_017705016.1.44346 XP_017832596.1.60252 XP_017832597.1.60252 XP_017951708.1.99540 XP_017951709.1.99540 XP_019064289.1.5607 XP_019307360.1.44245 XP_019307361.1.44245 XP_019307362.1.44245 XP_019349645.1.47583 XP_019373895.1.87953 XP_019373896.1.87953 XP_019406512.1.79039 XP_019406513.1.79039 XP_019406514.1.79039 XP_019501171.1.44202 XP_019501181.1.44202 XP_019501192.1.44202 XP_019581250.1.88060 XP_019581251.1.88060 XP_019581252.1.88060 XP_019662784.1.58354 XP_019662785.1.58354 XP_019662786.1.58354 XP_019662787.1.58354 XP_019662788.1.58354 XP_019688574.1.62641 XP_019779438.1.83887 XP_019779439.1.83887 XP_019779440.1.83887 XP_019824233.1.53367 XP_019824235.1.53367 XP_020035098.1.5219 XP_020141414.1.48125 XP_020141415.1.48125 XP_020141416.1.48125 XP_020742667.1.74333 XP_020742668.1.74333 XP_020957546.1.46622 XP_020957552.1.46622 XP_020957555.1.46622 XP_020957559.1.46622 XP_021058740.1.100879 XP_021058741.1.100879 XP_021058742.1.100879 XP_021058743.1.100879 XP_021058744.1.100879 XP_021058745.1.100879 XP_021507816.1.76796 XP_021557108.1.83697 XP_853464.2.84170 ENSEEUP00000002666 ENSNLEP00000015057 ENSDNOP00000010586 ENSPSIP00000010833 ENSMLUP00000001955 5he0_G 5he3_G 5ukm_G 6b3j_G 6d9h_G 6dde_C 6ddf_C 6e3y_G ENSMUSP00000055256 ENSMUSP00000124153 ENSMUSP00000124725 ENSMUSP00000125000 ENSMUSP00000125141 ENSMUSP00000125697 ENSPPYP00000006605 ENSLAFP00000002621 ENSOPRP00000001188 ENSCJAP00000012806 ENSPPYP00000006605 ENSFCAP00000019376 ENSXETP00000035970 ENSPSIP00000010833 ENSP00000334448 ENSP00000451102 ENSP00000451231 ENSP00000451576 ENSP00000452014 ENSSTOP00000015121 ENSOPRP00000001188 cath|current|2qnsB00/10-62 cath|current|3kj5B00/10-62 ENSAMEP00000002219 ENSOCUP00000012613 gi|54114974|ref|NP_444292.1| ENSECAP00000010301 ENSPTRP00000010751 ENSOGAP00000005871 ENSTSYP00000007348 ENSPVAP00000012629 ENSEEUP00000002666 ENSSTOP00000015121 ENSOCUP00000012613 ENSTTRP00000005402 ENSLAFP00000002621 ENSPCAP00000000371 ENSMMUP00000013618 ENSMMUP00000032911 ENSBTAP00000003959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]