SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000016411 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000016411
Domain Number 1 Region: 3-64
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 8.89e-18
Family Transducin (heterotrimeric G protein), gamma chain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000016411   Gene: ENSPVAG00000017395   Transcript: ENSPVAT00000017395
Sequence length 69
Comment pep:novel genescaffold:pteVam1:GeneScaffold_2846:72326:72945:-1 gene:ENSPVAG00000017395 transcript:ENSPVAT00000017395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQELSEKDLLKMEVEQLKKEVKNPRALISKTGKEIKDYVEAEAGNDPLLKGIPEDKNPF
KEKGTCMIS
Download sequence
Identical sequences XP_016013913.1.101085 XP_016013914.1.101085 XP_016013915.1.101085 XP_016013916.1.101085 ENSPVAP00000016411 ENSPVAP00000016411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]