SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|459290246|ref|YP_007513403.1| from Bradyrhizobium oligotrophicum S58

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|459290246|ref|YP_007513403.1|
Domain Number 1 Region: 7-97
Classification Level Classification E-value
Superfamily YccV-like 2.09e-34
Family YccV-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|459290246|ref|YP_007513403.1|
Sequence length 110
Comment hypothetical protein S58_38260 [Bradyrhizobium oligotrophicum S58]
Sequence
MIKARTAKFQIGQIVRHRVFSFRGVIFDIDPEFNNTEEWWLSIPEEVRPHKDQPFYHLLA
ENAESEYVAYVSEQNLVPDESGEPIRHSQVAEIFIKDKSGGYRPRHPLLN
Download sequence
Identical sequences M4Z960
WP_015666926.1.58237 gi|459290246|ref|YP_007513403.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]