SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385242544|ref|YP_005810383.1| from Chlamydia trachomatis G/9301

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385242544|ref|YP_005810383.1|
Domain Number 1 Region: 190-316
Classification Level Classification E-value
Superfamily CBS-domain pair 0.0000000000000096
Family CBS-domain pair 0.0029
Further Details:      
 
Domain Number 2 Region: 335-400
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.000000147
Family CorC/HlyC domain-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385242544|ref|YP_005810383.1|
Sequence length 404
Comment hypothetical protein CTG9301_01320 [Chlamydia trachomatis G/9301]
Sequence
METNSPFFWLGVNLLCIFVQGFFSMMEMACISFNRVRLQYYLTKSNKKASYINFLVRRPY
RLFGTVMLGVNIALQIGSESSRTCYKLLGISPEYAPATQIILVVIFAELIPLAISRKIPE
KIALKGAPILYFAHYLFYPLIQCVGGITNMIYFILNIKEETLHSTLSRDELQKTLETHHE
EHDFNVIATNIFSLSATSVEQVCQYLDQIPILSATASVRDVCQLVRRHRLDFVPVYHKVK
KNVVGIAFPKNLINRNPSDPVVPYLSSPWFITAKSKLIHAIQEFRKNSSNVAIVLNNNGE
PMGVLGLHTVFKTLFNTRNIAQLKPKPTSLIERTFSGNTPLSEIENELDIIFMDNDCTTI
EQLMLKLLDTPPEVGASIIINDLLLEVKEISLYGIKTVAIKDTL
Download sequence
Identical sequences A0A0E9DJG7 A0A0H2X1T7 G4NP80 O84259
gi|385240689|ref|YP_005808530.1| gi|568111507|ref|YP_008921106.1| gi|478459708|ref|YP_007733776.1| gi|385239768|ref|YP_005807610.1| NP_219762.1.57406 WP_010725142.1.101362 WP_010725142.1.102133 WP_010725142.1.13674 WP_010725142.1.17422 WP_010725142.1.30792 WP_010725142.1.31128 WP_010725142.1.34934 WP_010725142.1.38504 WP_010725142.1.4264 WP_010725142.1.42889 WP_010725142.1.43504 WP_010725142.1.55117 WP_010725142.1.60937 WP_010725142.1.6151 WP_010725142.1.61683 WP_010725142.1.62968 WP_010725142.1.65182 WP_010725142.1.67250 WP_010725142.1.69355 WP_010725142.1.71619 WP_010725142.1.71686 WP_010725142.1.72164 WP_010725142.1.74323 WP_010725142.1.75470 WP_010725142.1.77651 WP_010725142.1.83525 WP_010725142.1.86066 WP_010725142.1.93216 WP_010725142.1.9343 WP_010725142.1.93600 WP_010725142.1.97602 gi|237804602|ref|YP_002888756.1| gi|478458806|ref|YP_007731990.1| gi|385243464|ref|YP_005811310.1| gi|478448878|ref|YP_007723801.1| gi|385246154|ref|YP_005814976.1| gi|385269931|ref|YP_005813091.1| gi|385242544|ref|YP_005810383.1| gi|478455186|ref|YP_007727376.1| gi|478456994|ref|YP_007725587.1| gi|76788979|ref|YP_328065.1| gi|15604978|ref|NP_219762.1| gi|385244344|ref|YP_005812188.1| 272561.CT257 315277.CTA_0279 672161.CTB_2521 gi|478457905|ref|YP_007731090.1| gi|385269931|ref|YP_005813091.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]