SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385242719|ref|YP_005810558.1| from Chlamydia trachomatis G/9301

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385242719|ref|YP_005810558.1|
Domain Number 1 Region: 144-284
Classification Level Classification E-value
Superfamily CBS-domain pair 1.2e-26
Family CBS-domain pair 0.0077
Further Details:      
 
Domain Number 2 Region: 290-364
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 4.09e-17
Family CorC/HlyC domain-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385242719|ref|YP_005810558.1|
Sequence length 369
Comment putative cation efflux protein [Chlamydia trachomatis G/9301]
Sequence
MLYILLAIIVLFLFLGSATHRRASISAYGREGLPPFSSCPKVLPLLCLIYGMLGAPVYQY
IHNFFSLSPSIFWLIFLSFALVIYKFLPLCPGYSDDSFSYKVSSSTVKTLENCLAGFKTP
SITAMQQTPPPEPPNELSTNISCLDHMIAREIMTPKADIFALQGDTPISQAFPLIIDEGY
SRIPLFTKSIDDITGMVLVKDLSPVYYKDPHTSQPLSSIAYPPLYTPEIRRASLLLQEFR
QKRCHLAIVVNEYGFTEGLVSMEDIVEEIFGEIADEYDNQEDVHHKKIGNAWIVDGRMNI
SDAEECFGLHIEHESSYDTLGGYVFHKLGAVPEKGMKIYYEDFAIDILSCSDRSVEKMKI
TPRRRKPLS
Download sequence
Identical sequences A0A0H2X167 A0A2D3S0G1 G4NNG5
gi|478475200|ref|YP_007724869.1| gi|385246328|ref|YP_005815150.1| gi|478458981|ref|YP_007732165.1| gi|385239941|ref|YP_005807783.1| gi|527328728|ref|YP_008354918.1| gi|237802850|ref|YP_002888044.1| gi|385242719|ref|YP_005810558.1| gi|478449053|ref|YP_007723976.1| gi|527320126|ref|YP_008346326.1| gi|385270117|ref|YP_005813277.1| gi|385270117|ref|YP_005813277.1| WP_009871777.1.100644 WP_009871777.1.14984 WP_009871777.1.17422 WP_009871777.1.20093 WP_009871777.1.27980 WP_009871777.1.31128 WP_009871777.1.34934 WP_009871777.1.42889 WP_009871777.1.43504 WP_009871777.1.52091 WP_009871777.1.60937 WP_009871777.1.61004 WP_009871777.1.6151 WP_009871777.1.61683 WP_009871777.1.62968 WP_009871777.1.65182 WP_009871777.1.65391 WP_009871777.1.71686 WP_009871777.1.72034 WP_009871777.1.72164 WP_009871777.1.72442 WP_009871777.1.83525 WP_009871777.1.87079 WP_009871777.1.92427 WP_009871777.1.9343 WP_009871777.1.93600 WP_009871777.1.97602 gi|237804772|ref|YP_002888926.1| gi|385240865|ref|YP_005808706.1| gi|527325954|ref|YP_008352147.1| gi|76789156|ref|YP_328242.1| 315277.CTA_0462 580049.JALI_4241 672161.CTB_4241 gi|527322935|ref|YP_008349132.1| gi|478460785|ref|YP_007735736.1| gi|568111679|ref|YP_008921284.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]