SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000001575 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000001575
Domain Number 1 Region: 2166-2356
Classification Level Classification E-value
Superfamily BRCA2 helical domain 3.01e-74
Family BRCA2 helical domain 0.000000721
Further Details:      
 
Domain Number 2 Region: 2526-2660
Classification Level Classification E-value
Superfamily BRCA2 tower domain 4.45e-45
Family BRCA2 tower domain 0.0000749
Further Details:      
 
Domain Number 3 Region: 2357-2494
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.6e-40
Family Single strand DNA-binding domain, SSB 0.00000831
Further Details:      
 
Domain Number 4 Region: 2750-2885
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.57e-39
Family Single strand DNA-binding domain, SSB 0.0002
Further Details:      
 
Domain Number 5 Region: 2497-2525,2661-2747
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.11e-26
Family Single strand DNA-binding domain, SSB 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000001575   Gene: ENSPFOG00000001640   Transcript: ENSPFOT00000001578
Sequence length 3029
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519684.1:85746:101164:-1 gene:ENSPFOG00000001640 transcript:ENSPFOT00000001578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSCIKNMYDAFKGEIWKELGPLDPNWFELLTAQASLKEGSVADNDELCANQEGHFKAPL
EKTATESQLFSTPKVFRHSRIVSPDTEDDPSFTAAQEKETLPWMPTQSPCLFQVPKHCVS
NLKCEGVQPQSEESFDLLDSPEKSPATYANHISESLGAQINPDISWTSSLNTPPALPSTL
ILSKTDESPCPVSVTADRNVVFVRKLFPSLSNSSLKTSRTCQGPVFPVTETCSESPLNQS
ESHQQQKVADALEGEVCIADAPKTFFANSSSALRKVKPDRVKRKQIIQTNVDVCSHEDAS
KSDSAASNEEATADLDSGGLPPTPLVKTGDTAISQWSSLSLSEISSSAVGSNMTLPGDTD
SVQPTRPTSKITDSGFTQKKRKFVYTITTTKSQACGQDFELQTADLSLKISESEQENGKS
FVNIPDKEECQRTKNQRNIVEETINCSLGTKLQDIDMSQLCRDFALDFSQMTDLKTAENT
QRNFSPAACLSVMKQAKQNGKPANFPNDYSCISKNRRIPTSNQPCSISEVTMMDSGFQSG
VVDVTHMTSSSFGLPLLENVGQNRPTLSFKTGMHNFPSANGSGKSKFDVEVPVQRSGTGQ
APEHGKEIELHMASISTEELWDKEETVGQSKCSQPQKTPLSLLPAEASGFKTASNKGIHI
SLANLEKAKLFLEATEDKKSSLDNSTKSYHGIIYKTNSIRETTTDASSNTNPPACAGKSF
GNVSSQLTASEKADVTELCALLEEADSQFEFTQFRSGKKLPNHQDNHNPPHKEDKDLDPA
LLADIDFDDSFSSEGGKQSTVMMNDKVASVLENRTHGEKAKAINQCTGMSDLLKRETPLI
LPGAEDTEARCLENNKALIHSEAFRTAGGNVLHVSTKCLNKAKALFGDLERNLTDQKPSN
QNGENAAITEQKCNRDSDTFRKDSERKKENWDVGSKIENCFSKLEGVVCSNNNVGNRNDT
KSGKNNGIDTIICENGFRKASGKGISISANYMQEADVFFKDCHVMEHKEGKKSFSNFKSP
QVSISKKSVTGCTKLENVNTAVVSHHIKGLHLNEVERNTKFTAALKNEDGKSFPTSKPFA
MLHPSKSTDSSAFEELCTGDGFCTAAGKNISVSSAAMKKAEFLLNQIHAPEESLGDKISN
VDTGGFQAVDGKKFAISSAPLKKATLLRESEKSEDEMCISSQQPSPKIPVIPVTNLWSGG
FSAASGKPVILSSVALEKAQTLFSDISLNMVKVAESAPFKKDKKHQTEPENICSGFTTAG
GANDQMSQEKFDDLVLAKAVQEEEALSADGVLESNNVMWESAGSKKEDETPYADQRFRTN
TPVEAVKGCFRDTDKQEKHKENLLPQASCGFKTASGKKVEVSSEALKKAENLLGDCVGVM
DTVNAALPESKAIDLPVRNDGFRSASGKPVALSSEALQKAKSLFSDIGFGAEDPDASQMI
KSGKNQGGSNNTEKMSCGFTTARGEKVDVLQKNLQKAKVLFKELDDQVLSKAAQEEDAFF
AGHDMDINKEMLENDLKGKVHMQRSRKACLAKCYTDDEKRVSISIPECSRDANKQVEQRE
NILLQASCGFQTASGKRVDVSSEARKKAETLFSEFEEIQDKTNAMSSQSKPSALSLRNCG
FHSASGKPMAPSTEAVQKAKSLFGDITFSTEDSDFSQTVKAYGKQDSRSKTEKICCGFTT
AKGEKVDVSQKNLQRAKFLFKEVDDLDLTKAMQDADHFFNQEEGWSIESNSEKSSEKTNT
APVNESGSIKGNMSKLRTNTGSICEEPGNGSIKAKQNDSGFQTASGKTVAVSAEALSRAK
FLLSENKADEESTCVFAASGKPFSHEALQKAKTSTGGKSLPSGADSQSDDHIEEKSHFSI
CNLNTKSSNQISDNMQKNKSSDPKFQSLNLAGCTETQHKFLAQEALDCTKALLEDEVLVG
QSLLTTSENLQLLDYQQLSEKSAEEDKGRKRRSAEDLTAQPPSKRRLLEEFDRTANNPRG
SGLHPVKSGPNVHQGIMDRGVFRYGVFLHPNITKPNRDAKSFVDTRLQNTIQMPHSEQGD
GRSAACRMPTFVPPFFKNAKRDALNKPEARDRKKVPAFVPPFKKQRVVQQESSPTQQEDN
KQHHSLCLETNSKTDAPLTKTTQSCEEVVTLVNTSNTKTINQSVLKVGSVSSTEMLHVDD
KLSGSQDRTENIGLARDMQDMRIRKKKRQTIRPLPGSLFLTKTSGVARIPLKAAVNGNIP
GRYSAQELYECGVHKHVPEITSQNAESFRFNLLQFVKQETLAEGGGVQLADGGWLIPSDD
WTAGKEEFYRALCDTCGVDPKLVSEQWVYNHYRWIVWKQASMEKSFPGTMGSLCLTPEQV
LLQLKYRYDVEVDHSRRPALRKIMERDDTPAKTLVLCICEIISKCQLLHAQSCSDTKMSQ
SAETKVETPVAFVRLTDGWYAIKAQLDEPLTAMLHKGRLAVGGKLIIHGAQLMGSQDGCS
PLEAPDSLMLKICANSTRRARWDAKMGFHTDPRPFLLPISSLYSNGGAVGCVDIFILRSY
PMQQWMERKSDGGVVFRSVRAEEKEARRFNSHKQKAVELLFAKVQAEFEKEEEGSIKRQR
RRQTVGKQDIGNLQEGEDLYEAVGDDPAYLEAHLSEQQLETLQAYRRSLMEKKQAELQDR
YRRALDAEDNEMSCPKRDATPVWRLCVADSMTQSSCVHLVVYQLNLWRPSSDLQSLLKEG
RRFKVYNLVASDGKKRSSVETVQLTGTKKTQFQELQVSQEWVSSHFRQRISTDFVDLQNE
EFKPLCGEVDLTGLVISVVDQQGPSPAFYLVDGKKNFVKVRCFSSLSQAGLEDIVKPRVL
LALSNLQLRGQSIHPTPVVYAGDLTVFSTNPKEIHLQESLDQLKNVVQGQDHFFLTAEEK
LAHLIKSDGSCSSSLQPQTPVAARRQDSKTNVAFLKPIKSLGSFTPVSSNLPAATSSTEK
DPKTLKRKRALDYLSRVPSPPPISPLGSVVSPCVNKTFNPPRRSGPPSTLKPVQPAAPKA
TDSVVEDEWVNDEELAMIDTQALHVGNLF
Download sequence
Identical sequences A0A096LY08
ENSPFOP00000001575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]