SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000001848 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000001848
Domain Number 1 Region: 29-241
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 6.73e-67
Family D-ribulose-5-phosphate 3-epimerase 0.00000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000001848   Gene: ENSPFOG00000001914   Transcript: ENSPFOT00000001852
Sequence length 252
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519626.1:341767:347731:1 gene:ENSPFOG00000001914 transcript:ENSPFOT00000001852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLARLAASVPRLQARPTNSRHSMAYSAKIGPSILSSDLSCLGSECVRMMECGADYLHL
DVMDGHFVPNITFGHPMVECLRKTVGQDPFFDMHMMVSRPEQWVKPMAAAGASQYTFHLE
ATTNPGNLIKEIRESGMKVGLAIKPGTTVEELAPWANQVDMALVMTVEPGFGGQKFMEDM
MPKVSWLRSQFPSLDIEVDGGVGPDTIHKCAEAGANMIVSGSAVIGSDDPRSVIALLRTA
VAEAIQKRSLDR
Download sequence
Identical sequences A0A087X7U5
ENSPFOP00000001848 XP_007546424.1.10163 XP_014887613.1.100837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]