SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000002104 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000002104
Domain Number 1 Region: 21-103
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.41e-20
Family THAP domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000002104
Domain Number - Region: 240-277
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.00144
Family KorB DNA-binding domain-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000002104   Gene: ENSPFOG00000002274   Transcript: ENSPFOT00000002108
Sequence length 434
Comment pep:novel scaffold:PoeFor_5.1.2:KI519672.1:443261:445476:-1 gene:ENSPFOG00000002274 transcript:ENSPFOT00000002108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTMKSTQKIKYLRATGTTSEFCCVPLCPVSSRCNKFLSFFSFPADEELRKQWIVAIRRAN
LAIKGHTRVCSRHFKPEDIKEPEKEMGRRRLRKGAVPALFEWNNFSLPLPPPGVWETRKR
PPPEDSEEEANPPANVCIKEHDYASAPDPAVVDLVLEENDALREEVRQLREQAESLTLRQ
RFGIHRFASSDNDIRFFTRFASYDLLMRFWSMIEPALPSMVSIRQGQRGAAIDSASSTQT
LQPIDEFFLFLNYLALGSKQWDLADRYGVHQSTVSWIVTAWTNFLFTVLGSIRIWIPEDQ
IHSHLPADFKDYPDTTVILDCTELRCQCPSSPILQSEVFSSYKSHCTLVPCKVYRPAFFF
GRSQMSAREVRGTPAITRLGVHVESLIRRVKEHKLFDSEIPLGVLGIINQLYTVACLLTN
YENGPLTKGLGKEA
Download sequence
Identical sequences A0A087X8K1
ENSPFOP00000002104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]