SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000004985 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000004985
Domain Number 1 Region: 20-102
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.7e-19
Family THAP domain 0.00094
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000004985
Domain Number - Region: 231-267
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.00144
Family KorB DNA-binding domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000004985   Gene: ENSPFOG00000005109   Transcript: ENSPFOT00000004994
Sequence length 413
Comment pep:novel scaffold:PoeFor_5.1.2:KI519650.1:811905:814987:1 gene:ENSPFOG00000005109 transcript:ENSPFOT00000004994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMKRTQRFKHLRATGSTAEFCCVPFCPMTSRYNRVLSFFHFPSNLELRQQWIVAVRRENL
IIKAHTRVCSRHFKLRDIKEPASNGKRRLKCGAVPVLFEWNNYSLPFLEPAVVDLVLENN
ILRSLEKVAVDVLKEHNYASVPEAAVVDLVLENNILRKEIHQTQEQIGSLMLKQRFGIHH
FASSNKDIRFFTSRFASYDHLMRFWALIEPFLPTMISVQQNIDTTPSTHSLQPIDEFFLF
LNFLALGSKQQDLADQYGVHQSSVIQITTTWSNFLFTVHGSIRIWIPENQIHKNLPRDFE
DYPDTTVIIDSIALRCQCPSSPLLQSEVSSFYKSRCTLVPCKIYRPEFLSGGPQMPVGEV
RKTEAIAGLRVHVECLVRRVKEHKLFDPEIPLGVFGIVNQLYTVACLLTNYEH
Download sequence
Identical sequences A0A087XGT2
ENSPFOP00000004985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]