SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000005185 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000005185
Domain Number 1 Region: 175-317
Classification Level Classification E-value
Superfamily TPR-like 6.46e-22
Family Tetratricopeptide repeat (TPR) 0.0024
Further Details:      
 
Domain Number 2 Region: 2-93,128-156
Classification Level Classification E-value
Superfamily FKBP-like 6.22e-17
Family FKBP immunophilin/proline isomerase 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000005185   Gene: ENSPFOG00000005182   Transcript: ENSPFOT00000005194
Sequence length 327
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519754.1:1370521:1375501:1 gene:ENSPFOG00000005182 transcript:ENSPFOT00000005194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDTMLTGSEGIKKTILHGGTGDLPRFITGTKVTFHFRTQLCDDERTVLDDSKKVGTPME
IVIGNMFKLDIWETLLSSMRIGEVSEFWCDTIHTGVYPLVSKSMRRIAEGKDPVEWQVHT
CGMANMFAYHSLGYDDLDELMKEPKPLYFVLELLRVQQPSEYNRESWALSDEERLKAVPV
LHGQGNKLYKQGRYQEATQKYKEAIICIKNVQTKEKAWDVPWLKLEKMANTLTLNYCQCL
LRMEEYYEVIEHTTDIVNQHPGVAKAFYLRGKAHKEVWNEAEARQDFSRVLDLDPGMKKA
VKKELAVLNMRMEEKNQEDRDKYRGMF
Download sequence
Identical sequences ENSPFOP00000005185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]