SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000011765 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000011765
Domain Number 1 Region: 39-265
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.73e-26
Family Tryptophan biosynthesis enzymes 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000011765   Gene: ENSPFOG00000011770   Transcript: ENSPFOT00000011782
Sequence length 272
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519829.1:524477:530031:-1 gene:ENSPFOG00000011770 transcript:ENSPFOT00000011782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMKFQSLFGSLKSVVIGMIHAKALPGTPLGCLNMLQIVKEACHEAEVYLEAGIDGLIIEN
MHDVPYSFNLGPEVCACMTAVCSAVRHVCPTLPLGVQILSSANQQALAVALASGLDFIRA
EGFVFSHVADEGLLNACAGDLLRYRKQIGADGVQIFTDIKKKHSSHALTADVTIKETARA
AEFFLSDGVVITGAATGDQADPWELTEVSQSVKIPVLIGSGVTYDNVENFLDANGMIIGS
HFKHGGHWANAIDPERVKRFMAKIHHLRKQQS
Download sequence
Identical sequences ENSPFOP00000011765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]