SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000020669 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000020669
Domain Number 1 Region: 7-44
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.00000667
Family KorB DNA-binding domain-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000020669   Gene: ENSPFOG00000020543   Transcript: ENSPFOT00000020693
Sequence length 251
Comment pep:novel scaffold:PoeFor_5.1.2:KI519624.1:1294783:1295535:-1 gene:ENSPFOG00000020543 transcript:ENSPFOT00000020693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSSTRTLQPIDEFFLFLNYLALGSKQRDLAERYGVHQSTVSRIITAWTNFLFTVLGSIRI
WIPEDQIHRNLPANFKDYPDTTVILDCTELRCQCPSSPVLQSEVFSSYKSHCTLKGLIGI
APHGAVTFISRLYTGSISDKQITRESGLLTLLKPGMAVMVDRGFLIDDIVPCKVYRPAFL
SGRSQMSAGEVMETQAIARLRVHVERLIRRVKEHKLFESEIPLCLFGSINQLYTVACLLT
NYENGPLVKVW
Download sequence
Identical sequences ENSPFOP00000020669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]