SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000000469 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000000469
Domain Number 1 Region: 352-441
Classification Level Classification E-value
Superfamily TAFH domain-like 3.01e-35
Family TAFH domain-like 0.0000392
Further Details:      
 
Domain Number 2 Region: 636-684
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000293
Family TBP-associated factors, TAFs 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000000469   Gene: ENSPFOG00000000467   Transcript: ENSPFOT00000000470
Sequence length 849
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI520292.1:5340:20310:-1 gene:ENSPFOG00000000467 transcript:ENSPFOT00000000470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAGAPSLTALPVPVTLSSQPAASFPRAAVLAPSPPLNGSTGAGKVEGSPGAPPPGATLAS
QPGLPAPQSPAGSPAVTLQGLPSPVISTAQNGLDPKGSASLSAAQVLNHNNPLMHTKMLV
TSTPAPAPAAAQASIIQTQTGSSTPLAAAKPAINGVAQTGVRPPGAAVGAATSIQPQRPQ
LVTATTRPAAPQTPLAVRPQQQTTIQLPPGFTIPPGMVLVRTETGQLVLVPQQALAQAQA
KLQQSQTVVTQRPATPLTTSTIRVSTATTVPGAPQTVRLAAPAPTRIVQSPSTTSVQPLA
VPAAGAVKMPPPQKTSTVITAGVTPAAKPAPLPGGAATPPPAAPPGARVTVVSQEMQENV
KKCKNFLSTLIKLASHNSPSPDTSKNVKTLVQDLLDAKIEPEEFTSRLQAELKSSPQPYL
IPFLKKSLPALRQTLLNSQQSLTTAPPTTSAPPPAAPGSLTAAAIRPRLPVNATATTVRL
TPPITNTVTLSNPSFTALVSKMAQMFKINFQLYFGHKAVARATVQTIQTRSPVVLSQQIR
HPGFILKPALSESSPLAATLLRGPTTMAGKAPVHLAAQANQKKPTDPGGGTFRDDDDIND
VASMAGVNLNEENARILATSSELVGTKIRSCKDEAFLPPGLLHRRILDSAKKLGVTEVPL
EVVNLISHATESRLRSLLEKASVIAQHRTDGAKDEGNLTYEQSSDVRSQLRFFEALERME
KQRKDEQEREMLLKAAKSRARQEDPEQARLKQKAKEMQQQELAQMRQRDANLTALAAIGP
RKKRKLDSGGGASASSEVTSGSSSGSSASSSRQQLRQRITRVNLRDFILCLEQDRSSARS
LMLYKALLK
Download sequence
Identical sequences ENSPFOP00000000469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]