SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000005574 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000005574
Domain Number 1 Region: 25-168
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0000000131
Family Apolipoprotein 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000005574
Domain Number - Region: 183-224
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00392
Family Apolipoprotein 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000005574   Gene: ENSPFOG00000005684   Transcript: ENSPFOT00000005583
Sequence length 256
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519722.1:1626725:1628871:-1 gene:ENSPFOG00000005684 transcript:ENSPFOT00000005583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKILVILVLVFLTGCNGGQHDPPSKHQVKMVQDAFWDYVQKSTMTPKDYVWDIRQSHPGQ
YLCSLISHSVEAVQRFFRLVYAQIVMWSSRLYHRFCQEVDHLQQHLHHFLHHLEDDQFYH
AKELVAQIRWKMESIKMVAAHYIEALDPLGLKMALLEKTKELNEHLNSHHHPTGHSDHGC
GPETKKKIDESMEAFKASLFSLVSKFEVELAQTTKKINKKMVPLRKKHHGQLIKDSDHLK
DDLESLWQDWLLLSQQ
Download sequence
Identical sequences ENSPFOP00000005574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]