SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000005713 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000005713
Domain Number 1 Region: 1620-1740
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 7.81e-18
Family Lipoxigenase N-terminal domain 0.043
Further Details:      
 
Domain Number 2 Region: 387-458
Classification Level Classification E-value
Superfamily PKD domain 0.000000183
Family PKD domain 0.0073
Further Details:      
 
Domain Number 3 Region: 297-362
Classification Level Classification E-value
Superfamily PKD domain 0.00000183
Family PKD domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000005713   Gene: ENSPFOG00000005261   Transcript: ENSPFOT00000005722
Sequence length 2715
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519632.1:891362:910645:-1 gene:ENSPFOG00000005261 transcript:ENSPFOT00000005722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSARPEGEQAGRTLGEKVSGKLAGCWKQTADVHSTVSTLHLSVSQLSPGSYLRQGLLD
NLSCPSAHLGSSRKPIEVETVTQQADMSEGEEVLLCRGLTHKQREKIPEDVEKANPSSAD
CLKNTLAVACCFISDRSQDVSDNKMAAGDISDDNKLLKLTVEAESNHSSDNPRDCICTEK
HCNHELLFDLTKWVTSHQTCLVSCSISGKSNATVSLLVNAKVKQRGSSCTAGAEAAVVLL
FTRSGPVANQVLAENQVYFQSKSVIMCVKGKRKSEAKDITTEEPPDQSEKEKADVRIYAE
RQVYPTNKDIIFLVVTDIPDPVEFLWDFGDSRGARTRLRTITKRYHNPGRYNVVAAASWG
QMSVTSDVFRIEIQRVVKLSRLVHQASVLRNQTLTVTCRVNAGTDLTFIWSFGDGTTRPG
LSTTRQVFHSRLGEFAVKVIASNLISSASLSSYVFVVDRPCRPPHVKNMGPLKRQFQRHE
VIHLGVTFESDVECDISEGLRYSWTLLGSGGQIINLSHTDTQRQSLILQSHLLEYDTYNA
IARVQVIGSVVYSNYTVAFQVKPSPPVAFIQGGTNVFIGKTSSNVVTLDGQKSYDPDFPK
NPLSYSWACKPVSTITSSCFDQDIPTSSPVLKFPPSLLKTKFDQFQFTLTVLSRERSASS
EAFLTVTSHLTGKVSVFCHQCQGDHVNWDQSFSIRALCEDCSIHSELIQYTWSLYLVNAS
SKPITEVPFCYTVDVSSPSVILEDPTTSTLTPEMSKESKGQPDQSDLSRSGSSHTSVLDR
DTRLPRSREIQSESSADWRYAFPLMEADDVAHQPASSATGSGDYDAPYPSVEEGDSAGRS
YGTDTEIFSPIDHSESDLMLLTNEGSNLVDPKPSVAIQEPTLLDFHRDAVEKGLFESYTY
TGISSTLLIFRPFSLKPRSIYMLQVTAKSQNNWIGQTQLFLKTNPVPEGVRCQVRPVEGM
ELHTPFSIFCTSGREDLEYKYSYSIGGRPPRTMYQGRDFLYYFSLPSGDPRDDHEVKIYT
EIRSSSSGSATKPCPVAVRVRPSFIGNDSSSSPSHRDPALKLSECLRNLSSLVSLGNPVE
IRNYVSLLTSVLNKLGQDAEANTHAQRHTRNVLIRTLCDFKGSDEKSVADSIIILNELLQ
VTNQVTLTSVRHVATFVRSVSEILPEFSANRESLINSVSYCLQVVTSCNCTSKAADCFNR
TCVVEPGSPTAQSTKDSENASDSCAQESPAGPHLQHGGAAAANQLMEEILQTAADLMLRD
VLPHEAKQHRVTTGPVDLLASSQNRTSVIVRSGFTTVRMPAALIQSAFGLHDGGSRLSEQ
QSCVSRVLTQLDRNLCPRDAQLETGGAFTLTSFSQLTGPVVDFSLFKCNRRKIQIHSLPQ
PVDTEIQLPQRNESSTGRYVLLRNQISYHNFSISQQLLQQSIQITVTFTPLPSKPFPVML
LFSRMFERPTPNMHHLKRIHQWEQNTMRVTLPPSYLGAAGVAHMALLNAEFARLHRSRLQ
SEQISYSVTADSSLCLSWDGQQGVWTHRGCRTHQSDTSSAVNCSCYQLRPLTVYQQQIQI
SQVTGDLDPFLSASSDPVVLSILAVLLVLYILGLVWSQRADALSKENQRLYFLPDNNPAD
PYLYAVCIHTGLCSASRMTAKVYMVLQGEDGVSQTKELQVPGCTLFRRNTKDTFILSLRS
AADSLGPVRGVHVWHDNSGDSPDWYLKQVAVTEVSRGPAAERSWLFDGELWLSVNEGDGQ
VERKLRVSSGETRPVKMLFLRFFDYLADFHMWLCVYSCPSPSSHTHTQRLSVCLLLLSGY
ACANTVIISHADDQRPFEVGVVDVSAVSFTTGLQSVMVVLPVAALISFLFRLTGNTRSGS
GIQRAKREKTPHDDFQETFSADNSELDCHLSWDGRWRWKQEALKKKYQDSDVNSISSIRE
SKSMDEESAVQTRNDDRLQKLLLTSKGRAERRLPEQERFRRRNAEQRRPSFWCRSLAWAL
CALLSLSCLVVTAENGMRFSSSQVVLWIHSLCVSLLVCMFFIQPALIFGMTLTVCFWYKK
AANCHCFFSKKDPDEPEQFIKSDLCEKTSSSVEKLLRARHLRLARPPAPAELKKTCGKRR
REAVIREMLRDFSSCTLMLLLMVCIISGSSVKEHQNLNKAVKRHFIRHNFTFSSIKTHED
WWEWTQSSLLDYLYQNSSAKPEQPHVVIGEPVIQKTDGSSIFQNPVLTNPLTEKAPAVSL
GRTRSEAASKLKTLKSSSWMGRWMVALKVQFTLYSPAPHLFSSVSLISEQSPDGVLLHSV
KVQSVRVLHTTEPWDYVAMVSKLLFLLLILLQSYNQVSIVAQQGLMGCRRRPWMWLDVSL
LPVTLICYSCLTYHSAMIMEVVSLLQTQHRGHVDVSTAASWEQNIRTLWGVVLFLLTIKC
VTLLGMNRTLSSSAAVLTQTLSSLFWPVVSGLILLLALSCSGHLLHAGGCWPFSSVPRSL
PALLRRYRGLQVKKNRLCSGQDFSHWAVLFLTNTAVRTAMVIGVISLLVKMARRPQSRNI
TFTTGELLSYLRMKMSEFTGRQKRVRMDDHYSIKIHTHVLEELESSIDELLFRLDVLSNS
MNQTHRYREGDSPVLPASPQSSNIDAQEYLKSQTVVKTQKTQKSHEVTTPPAARLFRSKV
EMETPKISEGTSETLKIKNWMASPESTSSETLWSEDICEKQPELQAGTNHSCWFTGTHYK
LVEVLVHKEPEPGEP
Download sequence
Identical sequences ENSPFOP00000005713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]