SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000006725 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000006725
Domain Number 1 Region: 251-385,417-435
Classification Level Classification E-value
Superfamily Hemopexin-like domain 9.5e-27
Family Hemopexin-like domain 0.0011
Further Details:      
 
Domain Number 2 Region: 64-104
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000222
Family Somatomedin B domain 0.0011
Further Details:      
 
Domain Number 3 Region: 24-62
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000575
Family Somatomedin B domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000006725   Gene: ENSPFOG00000006768   Transcript: ENSPFOT00000006737
Sequence length 486
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519782.1:786508:792355:-1 gene:ENSPFOG00000006768 transcript:ENSPFOT00000006737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMMTKLRFLLLCLFATYAAAAAPGSCVGRCGEVFTRGQQCTCDFSCLQHKECCPDFLATC
TTTPSCRGRCSETFRRGRTCDCDPLCVQYNTCCQDFQLHCENVSGTIKTKQTEIPTKITD
VCGWMGQNVKRFNYKLEKENSLCEHFERRFGPTSPLPTGSLGSNPPAVPGDGNTAVGPLP
GQVSTSLGGTHQLSAVHLPRPSNGAPVLDGRVPVGSSTNGAEDGKLNVHLVIAPGGLNPS
GPSQGLMSNADLCSGSPINGLTALGNGTVLIFKGKLFWAVDSVGGSIGPPQNIRDTLGVS
SPIDTVFTRMDCSGNTYIIKGNQCWRLDENLMVKPGYPKPLTSEFPGLTGPISAALVVPA
TRNRLETIFFFKPGDIMQRFTVLPGSSASCRDKPKSSTLKNFAQQAAADVLLSGEINIKV
SLTGFPSPVTSALSMPAPQSTNPYQLFVFSGLFKYPVQITGDLPVLVKPDPPASLTPPPN
PVLSPL
Download sequence
Identical sequences A0A087XLS2
ENSPFOP00000006725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]