SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000007143 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000007143
Domain Number 1 Region: 438-840
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.98e-138
Family Ankyrin repeat 0.00000000000978
Further Details:      
 
Domain Number 2 Region: 201-456
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.3e-78
Family Ankyrin repeat 0.00000298
Further Details:      
 
Domain Number 3 Region: 44-201
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.84e-40
Family Ankyrin repeat 0.0000754
Further Details:      
 
Domain Number 4 Region: 1448-1533
Classification Level Classification E-value
Superfamily DEATH domain 2.05e-22
Family DEATH domain, DD 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000007143   Gene: ENSPFOG00000006144   Transcript: ENSPFOT00000007155
Sequence length 1905
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519756.1:1418780:1487883:-1 gene:ENSPFOG00000006144 transcript:ENSPFOT00000007155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQAAKQLRKTKDLAEAAAQEQREKEEEKIKKRNRSRDRRRKADAATSFLRAARSGNLDK
ALDHIKNGIVINIANQNGLNGLHLASKEGHVKMVLELLHAGIELEATTKKGNTALHIAAL
AGQEKVVAELINYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTHDGFTP
LAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGF
TPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNMMMVRLLLDRGAQIDA
KTKDELTPLHCAARNGHVRVIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQY
NAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSM
DLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRA
GHCEVAQFLLQNAAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPL
HIAAREGHVHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGK
NGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQVEVASVLLQNGAS
PNAESLQGITPLHLASQEGRPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTL
VKQGASVYATSRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHT
DIVTLLLKHGAMPNEITSNGTSPLGIAKRLGYISVIDVLKLVTEESVSTMTTEKHRMSFP
ETVDEILDVSEDEATGDELLGLDGARYLKLDDFKDQDDDFLSPKKTLRDFEGGTGTTPYS
PAIPRIPCVSPETVQLDQHTPIPLPKEYDEDSLIPSSPATETSDNVSPVASPIHTGFLVS
FMVDARGGSMRGSRHHGLRVIIPPRTCAAPTRITCRLVKPQKLTTPPPLVEGEGLASRII
SLGPSSMQFLGPVIVEIPHFASLARGDRELVVLRSENGSVWKEHRNRYGDEVLETILNGM
DEDLESQEELEKKRIRRIISTDFPLYFAVVSRIQQESDLIGPEGGRLTSKLVPHVEAIFP
ETAVTKRVRLGLQAQPIPDELLTRQLGNQATFSPVVTIEPRRRKFHRPIGLRIPLPPSWR
ESPRDAGEGDTTSLRLLCSVIGGTAPAQWEDITGTTKLMYASSCASFTTNVSARFWLADC
PRTAEAVTFANLLYKELMAVPYMAKFVIFAKMNEAREGRLRCYCMTDDKMDKTLELHENF
SEVARSRDIELMEGMPLHLECSGNLVPIRKATQQPRSFSFQAFRDNRLPVSVKVRDSNKE
ATGFLSFLRKCTKYEDSQHVLCNLNITMPPCVKVAGSEERRRTLTPLALRERYSALNEPG
VASVNAMERTEIKINIISDQLGLSWAELARELQFSVDDINRIRVENPNSLLDQSSALLNL
WLSREGKRAKMESLYTALKNIDRADIVSSLEGQAPQQGPGLSEEGACRLADRDSTLLSPS
VINGYGLVQEELVSPASMQYSLPSPLGVEPYWQEVSSLECAPIATTEEDTLMEMSDVQVW
PAGVSPSLVTVEDSSLDGSSRADDSEGATLSLPCSLGRPSSGASGASGSIMEEVEEEEVP
QEPASALAERDRVRATGAVPKVNLNGQPGGQRSDARRGDGVAVGGGTKGVGGVGLGSVEG
ISLVAGQQVYAQLGEMTGLRPPEHNGDNRMVGGGAFQPYLPDKDSLQGWVGSASSGHGGS
VPGLHTAQEALLTPVCDTGYSHVLRGHFLKGTQPFDKGLGFSHQETGQQAWEQGQRRGQK
EEKADYSAEAKFVEERGIALSRKVGMDVRKGAQSLQRTSLRRVKH
Download sequence
Identical sequences ENSPFOP00000007143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]