SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000007435 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000007435
Domain Number 1 Region: 23-246
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.75e-58
Family Ankyrin repeat 0.00028
Further Details:      
 
Domain Number 2 Region: 417-597
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000222
Family Tropomyosin 0.0033
Further Details:      
 
Domain Number 3 Region: 621-772
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000589
Family Tropomyosin 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000007435
Domain Number - Region: 959-1167
Classification Level Classification E-value
Superfamily Tropomyosin 0.000386
Family Tropomyosin 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000007435   Gene: ENSPFOG00000007243   Transcript: ENSPFOT00000007447
Sequence length 1377
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519763.1:964742:986478:1 gene:ENSPFOG00000007243 transcript:ENSPFOT00000007447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLSVLLHSLVECTEKTKENTDWNKYDDRLMKAVERGEVDKVATVLGKKGIIPTKLDVEGR
SAFHLAATQGQLECLNLMLGHNVEITAKDGSGKNALHLASKYGNSRCVQKLLQHNCPVGN
VDLQGRTALHDAVMAGCTSSVKLLCDNGASVNISDFDGRTPLILATQMCHPHICQLLLER
GADFNVRDKQNKTPLILGCEFGCKDAVEVLLKAGADVKAVDNMGHDAFHYARLSNKPELT
TMIKSHLDKANRVRKRSCKDRTVEAAAITLSVDRSDVAESNRKDQIIFDLERQNEALQEG
VRKYHLEHKLMTDKVNMLQHQLMQEKKAVDDSQKEKEQLKALLSAKDKEEGGRSPETVRV
MFTLLYSQGEYPGQSIIKGKESILVKQAQSLDFDQVGFISQPGYEQMPQNRPASRQLQRS
QTAGGWDHPEVESLRHELDTMQRKLQTAEEENGLLQTALNQKSRECQELAQSRDAVQKRA
DQQIQELEDALGDVQKRMLDSECKVKQLQAHVVAVKEHLGGQATEELRAQLQDVKAKYEG
ASSEVGRVRNRLKQSEKALEEYKSSESQLATETERLSQELAAQAAERDELSKALLTMETR
LNNTVPAEKYDNMKNLLTNAVDEKERQLAELREDYDRVLEEVAELHRKLDTPSSRVMSAE
EHQRIVSALEEQNATLKRKLKDVTAKSQTLIEEVEESEEERDLLKEQLDELNSRMENEFI
PIKDHEAIRDDMAVALEELKDKLVEAGERCGRAEGQLQQVQAEKAALQESMQGGSEKNQR
ELDVLKAHNAELMKKLQLVQKRCEDGEKEREELTAQKQALKRSVEEQFVSRQQHEKVKVE
LSSTLESVKADKLKLEAELKESAEELKNVKEGNEKLKEQLEKVTSEMKRECISMKEHKGV
ADELNAAVIEAENRANQASALHALAQEEVAKLSKELEAQKTELDTIQEAIQSKFIPLTAA
EEKETTYSSRVKELEQKLAETEEKYHRERSVWESMKQEKDKLKVETESVQQRLDSALVSS
KKHKQVEEEFKAKLEELAQRSASLEEQLQEATLQKTELQGQNALCNTQIQNLQEQLKSKL
MRIATYDTELTALQDSVHQAQADCKKAREAQQEEAHRVAILQKELQEQRREQTTLEAEVA
KLQASLREEEENNAQRAEDVRALQSELLRATQALEDVRHKEEQVNELKKVKQQLEDDVVS
LGDKLLSSTQECQKARLEQRQAKEGESRAKADMAAVQVVSQGVEREIRELRERYDESLGT
ISDLQRRIQESAQQTEAKDKKITELLTDVERLKQALNGLSQLTYTSSTPNKRQAQQVDAL
QAQITSLQQQLADAERKHREVVSIYRIHLLRAAQGHMDEDVQAVLLQILRMREEFVC
Download sequence
Identical sequences ENSPFOP00000007435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]