SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000009524 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000009524
Domain Number 1 Region: 400-803
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.98e-138
Family Ankyrin repeat 0.0000000000106
Further Details:      
 
Domain Number 2 Region: 105-418
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.24e-98
Family Ankyrin repeat 0.000000581
Further Details:      
 
Domain Number 3 Region: 1406-1489
Classification Level Classification E-value
Superfamily DEATH domain 6.06e-22
Family DEATH domain, DD 0.0046
Further Details:      
 
Domain Number 4 Region: 11-103
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.88e-20
Family Ankyrin repeat 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000009524   Gene: ENSPFOG00000008985   Transcript: ENSPFOT00000009537
Sequence length 1914
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519905.1:142248:188057:-1 gene:ENSPFOG00000008985 transcript:ENSPFOT00000009537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLLLQADAGNSFLRAARSGNLDKALEHIKNGIDINTANQNGLNGLHLASKEGHVKMVLEL
LHNGITLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQGFTPLYMAAQENHLE
VVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDD
TRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHI
ASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRIIEILLDHGAPIQAKTKNG
LSPIHMAAQGDHMDCVKQLLQYNAEIDDVTLDHLTPLHVAAHCGHHRMAKVLLDKGAKPN
SRALNGFTPLHIACKKNHMRVMDLLLKQSASLEAVTESGLTPLHVASFMGHLNIVKILLQ
KGASPSASNVKVETPLHMACRAGHFEVAEFLLENSAPVDAKAKDDQTPLHCAARMGHKEL
VKLLLDHKANPNSTTTAGHTPLHIAAREGHVQTVRILLDMEAQQTKMTKKGFTPLHVASK
YGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTA
LHIASKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDMVSLLISKQANVNLGN
KSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQA
NVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGAQPNETTTHGMSALAIAKRLGYISVIDV
LKLVTEETVSMTTTEKHRMSFPETVDEILDVSEDEGEELLGTEGARYMKMDDMKDHDDDF
LSPKKSLENYSPAIPRIPRVSPENVNLPEHEMDQQHTPLPLPKEYDEDSLIPSSPATETS
DNVSPVASPIHTGFLVSFMVDARGGSMRGSRHNGLRVIIPPRTCAAPTRITCRLVKPQKL
TSPPPLVEGEGLASRIISLGPAGMQFLGPVIVEIPHFAALGRGDRELVVLRSENGSVWKE
HRNRYGDEVLETILNGMDEELESQEELSKKRIRRIISTDFPLYFAVVSRVQQESDLIGPE
GGSLTSKLVPMVQATFPETAVTKRVRLGLQAQPVPDELVAKLLGNQANFSPVVTVEPRRR
KFHRPIGLRIPLPPSWRESPRDSGEGDTTSLRLLCSVIGGTAPAQWEDITGTTKLLYASD
CASFTTNVSARFWLADCPRTAEAVSFANLLYKELSAVPYMAKFVVFAKMNELREGRLRCY
CMTDDKMDKTLEQHENFTEVARSRDIEVMEGMPLHLECSGNLVPVRKATQQPRCFSFQAF
RDNRLPVSVKVRDSSKEPTGFLSFLRKSTKYEDSQQVLCNLNITMPPCIKIIGSEDRRRT
LTPLALRERYSALNEPAMASMSAMERTELKMAVIAEQLGLSWAELARELQLSVDDINRIR
VENPNSLLEQSSVLLNLWATREGKRAKMESLYTALKNIDRMDIINMLEGQPPQPMRQGSH
DLNRRRHNDRDHLSPGMTNGYGLAQEELHSPASMQYSLPSPLGAEPYWQEVSSLDCAPIA
TTEEDTLMEMSDVQVWPSGNSPSLVAVEDSSLECSNADDSEGLLGLPYGSLGRPASQASA
ASAGGVVLSGSIELPEDDSEMGVDSLSTTTPASIGGTIAGINLNGLNNGQGSETGSEEGH
SLVSGQQRVYARLSESPGLSCVADRNGDRSANGGNGSGGGSFLSYLQEQTGSGWMPVTDP
TQAWVGTQSKPRQAMETMISSVRNAVDVDPSLMSQEALLQPVRDMGHSEILRGHFRGTQP
FEKVINHTDTDHKKGDEVEDLAGGQISEEQFTDEHGNIVTKKIVRKVVRRGKGLGEEGVL
EVEGSLLDANELEGDAEQYLSYAILGRDGSKTDSVDVKKGAQIVKCASLRRVKQ
Download sequence
Identical sequences ENSPFOP00000009524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]