SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000010203 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000010203
Domain Number 1 Region: 367-461
Classification Level Classification E-value
Superfamily TAFH domain-like 1.96e-33
Family TAFH domain-like 0.00000773
Further Details:      
 
Domain Number 2 Region: 643-690
Classification Level Classification E-value
Superfamily Histone-fold 0.000000000000345
Family TBP-associated factors, TAFs 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000010203   Gene: ENSPFOG00000010171   Transcript: ENSPFOT00000010218
Sequence length 856
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519800.1:258071:273731:1 gene:ENSPFOG00000010171 transcript:ENSPFOT00000010218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGTAGITSAAEPITTAAQSHFDSLATSGAVTGASGATAGADKQQATGAPASDGNGAVMN
CHIPGSRQSDSSQTAPVNGPTSASPGFIIRTSLSAQNPSTSSGSSSQPAEKTVPTVALVR
PPPVQTSANESQSTDSPNTVLSSGSGSVSCKTEATKSITQAGAQVLPSGVLTATMRNPTV
LQNMRTTLSSTISAAPPGGIRTIAPQVLAPRLTQPQQNATSIQNIQIPAGMVLVRSESGQ
LLMIHQQTLAQMQAQAQSQSATTPRPAAPTSTPPVQVASLQTPGGPLLARSVTPTTIIKQ
GSPVQTTVATTATLQRPPVLQNTIILGGNATSTGQALGTPTTVQATAAVTQRVGPLGTTG
VPVTPTAITAETLENVKKCGNFLSTLIKLASNGKQSSETTATVKELVKNLLEGKMEPEDF
TSRLYKELNSSPQPYLVPFLKRSLPALRQMTPDPEAFIQQSLLPQPSSQPAAATSPALGA
VVLRPSLSPAVSAATGSTTTKATVITLSQKANSKPGLVVTQQQPVRPQVTLAQSPLVTVR
GAAPSRIIVGQPQMVRHIPQGSVVKQNVAPGTRGVQLLNQASLVDAQRNKLKEAGGGTFK
DDDDINDVTSMAGVNLSEENARIMASSSELVGIVTRSCKDEAFLSISSLTRIVLQIGKKF
GVSELGTDVINYISHATQQRLQNLLENASQVAQLKNFNFKEDERCEQVSDVRAQLKFFEQ
LDQMEKQRKEEQEREILLKAAKSRSRQEDPEQLRLKQKAKEMQQLELAQIRQREANLTAL
AAIGPRKKRRTDSPLSGASAEGSGLGSSQPGGSSGQGSRQFMRQRITRVNLRDLLLCLEN
DRDSSHSQLLYKGLLK
Download sequence
Identical sequences A0A087XWQ0
ENSPFOP00000010203 XP_007566367.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]