SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000011898 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000011898
Domain Number 1 Region: 311-439
Classification Level Classification E-value
Superfamily Plus3-like 2.09e-45
Family Plus3 0.000000414
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000011898   Gene: ENSPFOG00000011867   Transcript: ENSPFOT00000011915
Sequence length 670
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI520385.1:41501:53638:1 gene:ENSPFOG00000011867 transcript:ENSPFOT00000011915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNVKKRKVRNVIDSDSEDSASDDNLDQELLSLAKRKRVDSGEQEEPVNKPAASTDSETS
DSDDEWTVGGTKGKKKVKPGKGSEKKSATKKKVNKATASGSSDGDSSADSSAPEEGEVSD
SESNSSSSSSDSDSSEDEVFKDGYDDDLMGDAEDRARLEQMTEKEREQELFNRIEKREVL
RRRLVIPQRHTKLGVGSVSVLLFKQSQVQDTQVSMSHNKERRSKRDEKLDKKSQAMEELK
AEREKKKNKTAELLAKREPLKTSEVYSDDEEEEEEDDDKSSVKSDRSSRSSSFDEDEKEE
TPPKSQPVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNSSSKPVYRVAEI
VDVVETAKVYQLGSTRTNKGLQLRHGADTRVFRLEFVSNQEFTESEFMKWKEAMMVAGMQ
VPTLDEITKKEQSIKEAMNYKFNDKDIEDIVKEKDRFRKAPPNYAMKKTQLLKDKKAMAE
ENGDGEKVKTIQDELNELEERAEALDRQRTKNISAISYINQRNRSWNIVESEKALVAEGQ
NSKNQQMDPFTRRQCKPTMVSNARDPSVHAAILAHLNQKYGSGSGGADPASTEKNKVGPA
NPKDKDVPKPTTDLSEDLFKVHDFDVKIDLQVPNAEAKSLSVSSNALPVKDGAPRRSLNL
EDYKKRRGLI
Download sequence
Identical sequences ENSPFOP00000011898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]