SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000011980 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000011980
Domain Number 1 Region: 31-265
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.34e-79
Family Calponin-homology domain, CH-domain 0.0000738
Further Details:      
 
Domain Number 2 Region: 1337-1452
Classification Level Classification E-value
Superfamily E set domains 3.34e-36
Family Filamin repeat (rod domain) 0.0000142
Further Details:      
 
Domain Number 3 Region: 1049-1163
Classification Level Classification E-value
Superfamily E set domains 5.8e-36
Family Filamin repeat (rod domain) 0.00000364
Further Details:      
 
Domain Number 4 Region: 1537-1643
Classification Level Classification E-value
Superfamily E set domains 2.47e-31
Family Filamin repeat (rod domain) 0.00000805
Further Details:      
 
Domain Number 5 Region: 469-577
Classification Level Classification E-value
Superfamily E set domains 6.27e-31
Family Filamin repeat (rod domain) 0.0012
Further Details:      
 
Domain Number 6 Region: 1142-1259
Classification Level Classification E-value
Superfamily E set domains 6.67e-31
Family Filamin repeat (rod domain) 0.000083
Further Details:      
 
Domain Number 7 Region: 1451-1559
Classification Level Classification E-value
Superfamily E set domains 9.34e-31
Family Filamin repeat (rod domain) 0.0000265
Further Details:      
 
Domain Number 8 Region: 675-782
Classification Level Classification E-value
Superfamily E set domains 8.01e-29
Family Filamin repeat (rod domain) 0.00057
Further Details:      
 
Domain Number 9 Region: 1248-1358
Classification Level Classification E-value
Superfamily E set domains 2.27e-28
Family Filamin repeat (rod domain) 0.0000339
Further Details:      
 
Domain Number 10 Region: 750-875
Classification Level Classification E-value
Superfamily E set domains 2.4e-28
Family Filamin repeat (rod domain) 0.00073
Further Details:      
 
Domain Number 11 Region: 1851-1948
Classification Level Classification E-value
Superfamily E set domains 7.34e-28
Family Filamin repeat (rod domain) 0.00000975
Further Details:      
 
Domain Number 12 Region: 2318-2408
Classification Level Classification E-value
Superfamily E set domains 2.34e-27
Family Filamin repeat (rod domain) 0.00000751
Further Details:      
 
Domain Number 13 Region: 2039-2132
Classification Level Classification E-value
Superfamily E set domains 3.14e-27
Family Filamin repeat (rod domain) 0.0000235
Further Details:      
 
Domain Number 14 Region: 369-478
Classification Level Classification E-value
Superfamily E set domains 3.2e-27
Family Filamin repeat (rod domain) 0.0006
Further Details:      
 
Domain Number 15 Region: 567-670
Classification Level Classification E-value
Superfamily E set domains 4.47e-27
Family Filamin repeat (rod domain) 0.00013
Further Details:      
 
Domain Number 16 Region: 283-378
Classification Level Classification E-value
Superfamily E set domains 1.27e-25
Family Filamin repeat (rod domain) 0.0008
Further Details:      
 
Domain Number 17 Region: 865-975
Classification Level Classification E-value
Superfamily E set domains 2.4e-25
Family Filamin repeat (rod domain) 0.00078
Further Details:      
 
Domain Number 18 Region: 2644-2735
Classification Level Classification E-value
Superfamily E set domains 1e-24
Family Filamin repeat (rod domain) 0.0000106
Further Details:      
 
Domain Number 19 Region: 2509-2600
Classification Level Classification E-value
Superfamily E set domains 1.73e-23
Family Filamin repeat (rod domain) 0.0000106
Further Details:      
 
Domain Number 20 Region: 963-1065
Classification Level Classification E-value
Superfamily E set domains 1.47e-22
Family Filamin repeat (rod domain) 0.00085
Further Details:      
 
Domain Number 21 Region: 2248-2332
Classification Level Classification E-value
Superfamily E set domains 1.53e-21
Family Filamin repeat (rod domain) 0.00021
Further Details:      
 
Domain Number 22 Region: 2416-2505
Classification Level Classification E-value
Superfamily E set domains 1.93e-21
Family Filamin repeat (rod domain) 0.0000184
Further Details:      
 
Domain Number 23 Region: 1661-1745
Classification Level Classification E-value
Superfamily E set domains 1.8e-20
Family Filamin repeat (rod domain) 0.00016
Further Details:      
 
Domain Number 24 Region: 1785-1866
Classification Level Classification E-value
Superfamily E set domains 2.07e-17
Family Filamin repeat (rod domain) 0.0000833
Further Details:      
 
Domain Number 25 Region: 1955-2035
Classification Level Classification E-value
Superfamily E set domains 1.27e-16
Family Filamin repeat (rod domain) 0.000064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000011980   Gene: ENSPFOG00000011440   Transcript: ENSPFOT00000011997
Sequence length 2736
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI520015.1:69643:98464:-1 gene:ENSPFOG00000011440 transcript:ENSPFOT00000011997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSNNYGEDQLPPQYYQATDFGDEEDDEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKC
VNKTISDLQRDFSDGLKLISLLEVLSQKKMYRKHHSRPNFRQMKLENVSVALEFLDREHI
KLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDDEDDEETKKLTPKQRLLGWIQNK
VPQLPINNFNRDWRDGKALGALVDNCAPGLCPDWAEWDPNQPVQNAREAMQQADDWLGVP
QVIAPEEIVDPDVDEHSVMTYLSQFPKAKLKPGAPLKPKQLFPDKVKAYGPGIEPHGNKV
LQPAVFTVETLEAGSGEVLVFVEDPEGHKEEAKVKPNKNKNGTYTVTYLPKVEGVHKVKV
LFAGQDIDKSPYAVNVAKAMGDPSKVHARGPGLDATGNVANKPTYFDIYTAGAGTGDISV
VIVDPQGKKDTVELILENKGDSVFRCTYRPMLEGPHTIHVLFAGQEIPKSPFNVNIAEAI
NPNACRAAGRGLQPKGVRVKEVADFKVFTKGAGSGALNVSVKGPSGAEEQVKVRDAGNGV
YECEYYPLSPGKYTVSITWGGQPIARSPFEVEVGDEAGFQKVRAWGPGLKTGMVGKSADF
VVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDS
PFMAHILPAVNDVFPEKVKAYGPGLQPTGVIVNKPTEFTIDARMAGKGHLKIYAQDAEGC
TFNIKITDRGDGTFVCVYTPAKPIKHTIIITWGEVNVPNSPFRVLVGEGCHPDKVKVYGP
GVEKTGLKANEPTYFTVDCSEAGQALGDISIGIKCAPGVVGPAEADIDFDIIKNDNDTFT
VKYTPPGPGRYTIMVLFADQEIPISPFKVKVDPSHDAGKVRAEGPGLNKTGVEVVNPTHF
TIYTKGAGKAKPEVHFAASGPGDAVRDFEIIDNHDYSYTVKYTALQQGNMAISVTHGGDP
IPKSPFHITVAPALDIGKVKVEGLDTKVEVGRDQEFTVNTKGAGGQGNVGVKMTSPSGRP
IPCKLESDKAKGTHYVKYIPPEEGQYKVDVTYDGNPVMGSPFGVEAVIPADPSKVRAFGP
GLQGGIVGKPAPFTIDTKGAGAGGLGLTVEGPCEAKIECQDNGDGTCSVAYLPTEAGEYA
INILYAERHIPGSPFKAAVRPAFDPSKVTASGPGLEKAKAGEPAAFTVDCTRAGDAELTI
EIVSETGVKAEVRIQKTSEGTFSVTYIPSFHGTHTITIKYGGHAIPYFPKVLQVEPSVDT
SGVHVYGPGVEPRGVLREVTTHFIVDARALSKAGGNRVKVRVVNPSGANTDTYITDKGDG
TYRVEYTAFEDGMHLIEVLYDGAPAPKSPFRVFVVEGCDPTRVRAFGPGLEGGITNRPNC
FTVETRGAGTGGLGLTIEGASEAKISCKDNKDGSCSVEYVPFTPGDYDVNINYGGQPIPG
SPFRVPVKDPVDPTKVKCSGPGLGAGVRAHVPQTFTVDCTQAGQAPLDVKLYGPTGTVEP
VGVKNNGDGTHTVHYTPAQDGPYTVAVKYADQEVPHSPFKVMSQPGHDASKVRASGPGLD
TKGVSASLPVEFTIDARDAGEGLLTVQILDPEGKPKNATIQDNRDGTYTVSYVPDSTGPY
TITIKYGGDEIPYSPYRIQSLPTGDASKCRLTVSIGGHGVYAATLQKLQTSEDTVITVDA
KAAGKGKVTCKVLTPQGMELDMDVVENHDGTFDIYYTAPEPGKYVITIRFGGENIPKSPF
HVVACATSSNIKNIFRFVLLCHQASNEPVVPRDPVDPLFRPVNFLVPFTLQQGEITGEVR
MPSGKTSRPHITDNKDGTITIKYQPTERGLHEMDIKYDGNHIPGSPLQFFVDAVNSGVVT
AYGPGLSYGMVNRAATFTVVTKNAGEETGGLSLAVEGPSKAEITCKDNKDGTCTVSYLPT
APGDYNIIVKFDNKHIPGSPFTAKITGDDTITRTSQLNVGTAADVSLKIAETDLNSLTAS
IRAPSGNEEPCLLKRLPNRHLGISFTPKEVGEHEVSVRKNGMHVANSPFKIMVGQSEIGE
ASRVKAFGKGLVEAHTFEMAEFFVDTRNAGYGGLALSIEGPSKVDINCEDVEDGTCRVTY
CPTEPGSYIVNIKFAEKHIPGSPFTVKVTGEGRIKESITRKRQASSIASVGSTCGLNLKI
PAGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGGGGG
SPFRDVFGDFLGRESLSSFAGIAARPEPAESGSQAMTAQVTSPSGKTVDADIMDGGSSTY
SVRFIPQEIGPHTVNVKYRGQHVPGSPFQFTVGPMGEGGAHKVRAGGPGLERGVAGAPTE
FSIWTREAGAGGLSIAVEGPSKAEISFEDRKDGSCGVSYVVKEPGDYEVSIKFNNEHIPD
SPFIVPIATLSDEARRLTVTSLQEKDLKVNQEASFMVQRNGARGAVDAKVHTPSGSSEEC
YVSDLDGDKSAIRFIPRENGVHSIDVKFNGCHIPGSPFNVRVGDPGLIADPGMVTAHGAG
LLGGTTGVPSEFVVNTCNAGSGALSVNIDGPSKVKMDCRECPEGYRITYTPMAPGNYLIT
IKYGGPQHIVGSPFKAKITAGARLSGGHSLHETSSVLVETVTKTSKVGGAYSSSSSATSA
KLTCDASKVVCRGAGLSKALVGQKNNFTVDCSKAGTNMLMVGVHGPLAPCEEVYVKHMGN
KLYNVTYTVKDKGSYTVIVKWGDDNVPGSPYKVTVP
Download sequence
Identical sequences ENSPFOP00000011980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]