SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000013060 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000013060
Domain Number 1 Region: 197-489
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 8.24e-95
Family Cryptochrome/photolyase FAD-binding domain 0.0000144
Further Details:      
 
Domain Number 2 Region: 5-190
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 1.15e-53
Family Cryptochrome/photolyase, N-terminal domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000013060   Gene: ENSPFOG00000012936   Transcript: ENSPFOT00000013078
Sequence length 672
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519810.1:522222:549865:-1 gene:ENSPFOG00000012936 transcript:ENSPFOT00000013078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPNSIHWFRKGLRLHDNPALQEAVRGAGTVRCVYFLDPWFAGSSNVGVNRWRFLLQCLE
DLDASLRKLNSRLFVIRGQPANVFPRLFKEWKISRLTFEYDSEPFGKERDAAIKKLAMEA
GVEVIVKISHTLYDLDKIIELNGGQPPLTYKRFQTLISRLDPPEMPVETLSDALMGGCVT
PVAEDHGEKYGVPSLEELGFDTEGLPSAVWPGGETEALTRIERHLERKAWVANFERPRMN
ANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYRKVKKNSSPPLSLYGQLLWREFFYTAA
TNNPRFDKMEGNPICVRIPWDKNPEALAKWAEAKTGFPWIDAIMTQLRQEGWIHHLARHA
VACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFFHCYCPVGFGR
RTDPNGDFIRRYLPVLRGFPAKFIYDPWNAPESVQAAAKCIIGVHYPKPMVHHAEASRLN
IERMKQLYQQLSRYRGLGLLASVPSTNGNGNGGMMAYSPGEQQSGTNNNNSHLPGVSGSS
VATGNGSGSILFNFDNEEQTGPSSFGQQQQQRLHTLPQNQHQQQHAGYHSVPDASQNITS
SRLYHEFAVPQHPGLLLHTRGSGITGKRERESEREGSREEEPACCSVNKMQRQSAEVSPQ
SAEELSISFSFK
Download sequence
Identical sequences ENSPFOP00000013060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]