SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000014154 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000014154
Domain Number 1 Region: 492-629,658-725
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.62e-35
Family Hemopexin-like domain 0.00092
Further Details:      
 
Domain Number 2 Region: 57-95
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000183
Family Somatomedin B domain 0.0014
Further Details:      
 
Domain Number 3 Region: 17-55
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000301
Family Somatomedin B domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000014154   Gene: ENSPFOG00000014119   Transcript: ENSPFOT00000014174
Sequence length 728
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519648.1:2805036:2818683:-1 gene:ENSPFOG00000014119 transcript:ENSPFOT00000014174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ICNYQSMFFLFALFPTASCRGRCGAEYYRGNMCQCDFTCLSYDECCNDYEAQCTTKNSCK
GRCGETFKRGRRCTCDFECSKFKQCCPDFKNHCDVDAVITAEKSGGATGPMTGSSCDNVH
NNPKDSTAAKDPELSEGNNAGEITICFFSAFILLDVGRVHETVLNLTPYPPMDLDDGDGE
QKHHEEFSKQLFPDTTITVCINISLVDIFAEIFPNDDLSTNGDVQPEASPTPEVSSGDGL
TPVEPLDEIPTEPTLIRDDPQFNTEPTPVDDIFTLAAVTTGRTVNCENNVVIVFPSQDPT
EPTSVDPDQTTTPLVPSEPNSGVLDLSLTSELQTEPTASSGASAIETEISPSDAPEVSHT
NAKDLMEELENSQLTTTSGLSTLASVTEETTSSPNTESSPESITTSSPDVLQDVSDATLT
PAGDELLSSTAAAPDSASGGVNPDETTAEPDSKPDPSKASPTSKPESKPLEPQTQITDNL
KDYQGDDSDDTNLCSGRPVSGITTLRNGTMVVFRAGHYFWVLDRNLVPSSPKGITAVWGV
PSPIDTVFTRCNCQGKTYIFKGGKYWRFENDALDPGYPKVVKTGFDGLQGHITAALSVPQ
YLSRKESVYFFKRGGTVQKYSYQFGTSPKCGRTANVPVYTVRARLVRQAVSVLEPAINIR
RSWKGFPSTITAAVSVPTNRNPEGYKYVVFSRSTAYNVRMHDGRPVVAAPRANVSPKTDN
FFRCPKKS
Download sequence
Identical sequences ENSPFOP00000014154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]