SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000014349 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000014349
Domain Number 1 Region: 459-548
Classification Level Classification E-value
Superfamily TAFH domain-like 3.53e-35
Family TAFH domain-like 0.0000392
Further Details:      
 
Domain Number 2 Region: 744-792
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000349
Family TBP-associated factors, TAFs 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000014349   Gene: ENSPFOG00000014290   Transcript: ENSPFOT00000014371
Sequence length 957
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519856.1:933792:949297:-1 gene:ENSPFOG00000014290 transcript:ENSPFOT00000014371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSTEVDEKAVSDLVGSLESQLGDRNLPAASDPDGKRDVAAASRLSGKAGSSEPQQGHQT
AGSTREPGANQPLSGQTVPSSVTAGAIRNTGTGLQAAGAPSLTALPVPVTLSSQPAASFP
RAAALAPSPVEAIRTSSPSLQPLNGSTGAGKVEGSPGAPPPGATLASQPGLPAPQSPAGS
PAVTLQGLPSPVISTAQNGLDPKGSASLSAAQVLNHNNPLMHTKMLVTSTPAPAPAAAQA
SIIQTQTGSSTPLAAAKPAINGVAQTGVRPPGAAVGAATSIQPQRPQLVTATTRPAAPQT
PLAVRPQQQTTIQLPPGFTIPPGMVLVRTETGQLVLVPQQALAQAQAKLQQSQTVVTQRP
ATPLTTSTIRVSTATTVPGAPQTVRLAAPAPTRIVQSPSTTSVQPLAVPAAGAVKMPPPQ
KTSTVITAGVTPAAKPAPLPGGAATPPPAAPPGARVTVVSQEMQENVKKCKNFLSTLIKL
ASHNSPSPDTSKNVKTLVQDLLDAKIEPEEFTSRLQAELKSSPQPYLIPFLKKSLPALRQ
TLLNSQQSLTTAPPTTSAPPPAAPGSLTAAAIRPRLPVNATATTVRLTPPITNTVTLSNP
SFTALVSKMAQMFKINFQLYFGHKAVARATVQTIQTRSPVVLSQQIRHPVIEIGRPALSE
SSPLAATLLRGPTTMAGKAPVHLAAQANQKKPTDPGGGTFRDDDDINDVASMAGVNLNEE
NARILATSSELVGTKIRSCKDEAFLPPGLLHRRILDSAKKLGVTEVPLEVVNLISHATES
RLRSLLEKASVIAQHRTDGAKDEGNLTYEQSSDVRSQLRFFEALERMEKQRKDEQEREML
LKAAKSRARQEDPEQARLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKLDSGGGA
SASSEVTSGSGSGSSASSSRQQLRQRITRVNLRDFILCLEQDRSSARSLMLYKALLK
Download sequence
Identical sequences ENSPFOP00000014349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]