SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000014732 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000014732
Domain Number 1 Region: 612-711
Classification Level Classification E-value
Superfamily TAFH domain-like 7.59e-35
Family TAFH domain-like 0.0000442
Further Details:      
 
Domain Number 2 Region: 858-906
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000544
Family TBP-associated factors, TAFs 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000014732   Gene: ENSPFOG00000014662   Transcript: ENSPFOT00000014754
Sequence length 1017
Comment pep:novel scaffold:PoeFor_5.1.2:KI519656.1:522848:637317:-1 gene:ENSPFOG00000014662 transcript:ENSPFOT00000014754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGASDPLEDMLFSEVDEKAVSDLVGSLESQLTGQSNSAGKADENGGAGSVAPANHHLGK
TLPAPVSTTTLEQQQQPGRRNKPEMRQEVNSKDASPDKIVTSLSLSCSSSFGEPPSTSAG
CVNATSSGIQSHGASITPLTASGVSTLASPQDSISTTSSRSAKVSQCTGEAPAEASAPRK
RVATPRRSPSARIKSLNGAAVTTRRSSITAVTDSSIISSVDPGATPPNSTRSAINTSTFT
LSNANLPVGQSAIPLDRGTPTIALHRLPSHIVASIAQNGNGTSVSALVQQGARIEPATSS
SPTGDLSKAATDTGASKTDDCQSNIVTQSQVGSVSSVINTVLPSASCAITPATTTTAAPT
TTTTVTQPLSSATTAVCTTAMATTSVCGTVQTTAVTSTMSMVRPTAPSPTPAVATPALSQ
PRPGVPTPQRIVAPQLIVRPSQQQTTIQLPPGFTIPQGMVLVRTELGQLVLVPQQALAQA
QAQAQAQNNISPRPAAPTTGTSFRVTTPQQSPATSQTTRPCPLTPAKMAPSPSPAPSSPA
LLRSRYSLKNWVCCPALRPKGPVVPTVAVTAPQQAPMAITPQAQAQPTSQPAAQTQTSVA
AAPGAPVVSQEMQENVKKCKNFLATLIKLASHNSPSPETSKNVKALVQDLLDAKIEPEEF
TSRLQTELKSSPQPYLVPFLKKSLPALRLSLLNSQQSLTQPLQQGVKPAAGSTPPAMVAG
PAVRIRHPNSVSTTAGASVLPAGTVGHAAAMGVKTGGTVSGPVRMPMVITQSIRPQGTIG
KGAIIQAGKSPMGLPVQISGNQKNKLNDPGGGSFRDDDDINDVASMAGVNLNEESARILA
TNSELVGTQIRSCKDEAFLHPGLLHRRILETAKKFGVTEVPMEAVTFISHAAQSRLRTVL
EKVSIIAQHRIDSCKDDECYEQSADVRSQLRFFEQLERIEKQRKDEQEREILLKAAKSRS
RQEDPEQARLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKLDSPGATPSGTE
Download sequence
Identical sequences ENSPFOP00000014732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]