SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000015307 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000015307
Domain Number 1 Region: 197-485
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 3.66e-95
Family Cryptochrome/photolyase FAD-binding domain 0.0000146
Further Details:      
 
Domain Number 2 Region: 2-213
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 1.31e-52
Family Cryptochrome/photolyase, N-terminal domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000015307   Gene: ENSPFOG00000015153   Transcript: ENSPFOT00000015329
Sequence length 574
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519819.1:643673:658478:-1 gene:ENSPFOG00000015153 transcript:ENSPFOT00000015329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSVHWFRKGLRLHDNPALQEALNGADTVRCVYVLDPWFAGAANVGINRWRWRFLLESLED
LDNSLKKLNSRLFVVRGQPTEVFPRLFKEWSVTRLTFEYDPEPYGKERDGAIIKMAQEFG
VETVVRNSHTLYNLDRIIEMNNNNPPLTFKRFQAIVSRLELPRRPLTPVSQQQMNRCLGK
ISDNHDQLYSIPSLEELGFRTAGLPPAVWRGGESEALDRLSRYLDKNVWVANTRVKTCSL
YASPTGLSPYLRFGCLSCRVLYYNLREIYMKLCKRSSPPLSLYGQLLWREFFYTAATNNP
NFDRMEGNPICVQIPWDQNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHRARHAVACF
LTRGDLWISWESGMKVFEELLLDADWSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDP
SGDYIRRYIPILKDFPNRYIYEPWNAPESLQKAANCVVGVDYPKPMINHAEGSRLNIERM
KQVYQQLSHYRGLSLLASVPTIQEEAEPPMTDESQTSSGPGTDHCTSSGQPSSPASSPPQ
SPAPRSKPGSPSSSCPSPSASPSSLPPRRKGVAH
Download sequence
Identical sequences ENSPFOP00000015307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]