SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000016321 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000016321
Domain Number 1 Region: 198-487
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 6.54e-97
Family Cryptochrome/photolyase FAD-binding domain 0.00000837
Further Details:      
 
Domain Number 2 Region: 4-172
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 4.19e-50
Family Cryptochrome/photolyase, N-terminal domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000016321   Gene: ENSPFOG00000016246   Transcript: ENSPFOT00000016343
Sequence length 522
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519848.1:628057:632083:1 gene:ENSPFOG00000016246 transcript:ENSPFOT00000016343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHVCIHWFRKGLRLHDNPALMAALKDCKELYPVFILDPYLHHAQVGINRQRFLIGALKD
LDCSLRKLNSRLFVLRGKPEDVFPKLFNRWNVTKLTYEYDTEPYSLRRDEKVASLAKEHG
VDVIYKISHTLYNIERIIEENNGKPPLTYKRLQAIVQNLGPPKKPIPAPTLENMREDVKT
PGSQKYEDKYRIPTLEELRLDSQFLGEELFPGGEQEALRRLDEHMKRTGWVCSFEKPQTS
PNSLSPSTTVLSPYITFGCLSVRTFWWRLTEVYRGRKHSDPPVSLHGQLLWREFFYTCSV
GIPNFNKMNENPVCTKVDWDTNQKYLAAWREARTGFPFIDAIMTQLRQEGWIHHLARHAV
ACFLTRGDLWISWEEGQKVFEDLLLDGDWALNAGNWQWLSASAFFHQFFRVYSPIAFGKK
TDKNGDYIKKYLPLLKKFPPEYIYEPWKAPRSVQQAAGCIVGKDYPHPIVQHEQVSKKNI
QRMKEAYAKRSSDNNESPIKKQGVKRKAPSVIEMLQKKSRKE
Download sequence
Identical sequences ENSPFOP00000016321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]