SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000017088 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000017088
Domain Number 1 Region: 2-572
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 2.62e-80
Family Acetyl-CoA synthetase-like 0.0000333
Further Details:      
 
Domain Number 2 Region: 710-1054
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 8.77e-49
Family Quinoprotein alcohol dehydrogenase-like 0.0023
Further Details:      
 
Domain Number 3 Region: 563-615
Classification Level Classification E-value
Superfamily ACP-like 0.0000317
Family Peptidyl carrier domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000017088   Gene: ENSPFOG00000016997   Transcript: ENSPFOT00000017110
Sequence length 1057
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519647.1:1751386:1759028:1 gene:ENSPFOG00000016997 transcript:ENSPFOT00000017110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTLQDLVSAAASLHPDRAAVLYDSGSGETPGSLLYREVVQLAEDLSAALLQTCSPRDGAV
GLYCSDDLLVPAWILGILQSSAAYVPLDPEAPGLLTARVMSQCGLKYCAVNRDLVQVEPC
ISKTLIANEAVVDHVPVEVCVELPQFRLTLMHIEPRPVAEDGPQRAGGCDPSDKTVPLKD
SGRPDLAYILHTSGTTGPPKTVRVPHRCIVPNILHLRSLFQMSADDVVFLASPLTFDPSV
VDIFLTLSSGALLLIVPSVMKKMPGRLAQMLFKHHRATVLQQVTPTLLVRFGHGILKRDV
LSPGSSLRVLALGGEACPSPAQLRSWKHEENKTAVYNIYGVTEVSCWASCCRVPDPQLLC
SSLTASSVPLGTPLMDTVVEVRDEDDCIITEGEGQVFIGGGEDRVCLLDGEDTVVPGTMR
ATGDWVNVKDGQLYYLGRRDRMIKRNGKRVNLDSLQQLILSLPQVEACAVGLYKEYRLLA
FVVASASEVHLHQGEPEGAGRDLQRLILKQLSLLVSAHCIPDALVLVPALSLTPHGKADM
KALMRIYEKQREWLRSSRLEVGKLKQTLETLWQDTLGLPADASIDERSNFLFSGGDSLKA
LRLCEDILATVGVSSPRLLEVILDRSFSEVLRHVTQMLPPEPDGSSSSKKRAAEAPSGVP
AKKGPRSDRTQRETLGCKVVRRGGEVQGTNFRSVDAGEEEPLDGKDVGVRLGPSWSSDTG
RCVDASPVILVRDVADEQSRATVFIGSHSHRIQALDLASGNLLWERVLGDRIEASAAVSH
CGSLVVVGSYDGCVYFLCTDSGETKWVFKTEDAVKSCPAVDPFTGLVVVGSHDGHVYALD
PQLRRCVWKRDCGGGAVFSSPHLESSRRRLYAATLGGRLLCLNMDSGDVLWSYCRDKPFF
SSPNSSCGHIAIGSVDGNICCLSDSGELLWQYRTEAPVFSSPSFVPGQQRLLCGSHDGRL
YCLSCADGSIVWTFQTSGKVYSTPCVFQGSAVGRRGALVGLASTDGTVWILDARDGRVLA
SSALPGELFSSPVVWEQSLVIGCRNDYVYCLNLTGNV
Download sequence
Identical sequences ENSPFOP00000017088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]