SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000018221 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000018221
Domain Number 1 Region: 1639-1893
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000366
Family Tropomyosin 0.0025
Further Details:      
 
Domain Number 2 Region: 1466-1652
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000785
Family Tropomyosin 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000018221
Domain Number - Region: 1232-1417
Classification Level Classification E-value
Superfamily Tropomyosin 0.00061
Family Tropomyosin 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000018221   Gene: ENSPFOG00000018061   Transcript: ENSPFOT00000018243
Sequence length 1982
Comment pep:novel scaffold:PoeFor_5.1.2:KI520231.1:113657:142018:1 gene:ENSPFOG00000018061 transcript:ENSPFOT00000018243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETAAMSGEKNSDSNKLESVIQLNQRLEESVLSEEKRLTVRGPSPDAAPTCLPARVREIVT
KNLNDTKSELALSAAGAMSSVMSVQEENRVLQGELARLEDLLAHSRADRDELAIKYGAIS
ERLEQALRLETGEGDLDSPESRSLAQQNVDLRRRLDEEQAAYRRKLTAYQEGQQRQAQLV
QKLQAKVLQYKKKCGDLEQMLQEKSSEVEKEQQRNEDVSSNLEEALIRLEEEQQRSSSLS
AVNAMLREQLEQAGLANEALSQDIRRLTVDWTKAREELEQKESEFWGCRAEPESFHSYFS
SEHGRLLKLWRQVVGFRRHVCEMKSATERDLSEMRSELARMSHSARVSCSGLSTSVDSRA
AGEKALRVQLEQQLRERAAEMMSLQSRAEAEKSELNVRLSDVVRECERLKGQIVERDAEI
STLTQRFEEQSGSDEPDTQLIKAQSEMLLDTLRDIAQSVLSDGESSSEADQDRSAAPLLA
LIRDASARRSSSPLKMATAPPASSPSPLPDAALSALRSAVANKTLQLQDVRGRLLSAQSS
VQQLRKQLSDSDSSRRDSEQRNQALQRERDAAQRERENAQKEKDRLKQDRDALASEKAKL
EQSVQAAESSVQMLQMEREKLQLALLAAQRERDGEREEKEAANQERDRAKAETQRIQKQR
DLSESRASAQRGELSAVRESHQQGEVERQLLQREKAQLSEALARAESCSTELSLQLSRLQ
SEEAALRDSLAKMGGMNEALAQDKVDLNNYILQLEEEKRVLLAQRREAEQERLTIRDELV
RLEQDRLELDAGRVALQQALQDAEQSRAGTESELQSLRAERLRLQQKVTQVPNRVASLGS
ELSLAQGEGQKNEAALEEAGRGRADLARDKAALVVQLTASERENSALSEELAAFRSERES
LETGLFEAQQQLALVESRRDQLEAENQALSARCETAAAELKRLRSDDAIALAQAEREKQT
LTQSLGAAQLEAQQALRKAISEHQEEVERLVSEKEVVRHSLQMEQEAALRRCRQEMDDQQ
QRAKRDREELQEQLSALQHDRDQSLLQAETEKQQALSLKEAEKAVLCDRVSGLQAELSAA
ALEAERTAREAAQLKEQEQIRVGALTSELLELRSRLDEATSAHQRELHALQELCTDLRSR
ADVALKELEQCRASLSAAEESRDQVRRSLLEAERRLSQTQEASENCRRDAAEQRRALSDI
TKERDALSQSNTQLRGTLRSAETERINLSSSQKEVTELRSCLREVERSRLEARRELQELR
RQLKVVDAEKEQRGREVAELQTRLVLEEQREEERGKEVFSLKQKLAEAETARESIKKELA
LTQRRLTESESGWRSCERELTAQLQDARGCEKKLQDEAKNLSLRAQAAHDAAALSGLQLS
EAQGRLAATEAELTRAEAARRDLEFRLSGLQSALTRTLGIGASGRGCRGRSPGSSSTSPG
SVSRHHSISPLRSSLSPPKERGDTPLPQSELDPDSLRSGLRDFLQELRDAQRERDDARCQ
LGVLQRELEELKGERGSAQSRFSLLQSSLQELQEVRRGLDERLTTTQILLQQQEEAVRRG
DRDRRALSDRVKELERSLQSSEADKKHTQDQLNKQRAAEARLEAERKRLREALEAAEARA
TRVELGRRSLEGELQRLKLSLGDREAESQTSQQRHDALIKQVAEKEARVSQLQRDVDSLS
QNLLKAQEGESALKEKAASLSQTLQEVTASHSGTQSRLLALQKTLGLAEQDKRLLQERLD
EARAALAEGKRNMAALTERMQNLQSELSQSELRREELEAELSSTQEALRQRSATLVEAQR
SAQQVQTERAVVEERLRALQRAVALLETEKKDAERQAVRLEKDKNALRNTLDKVERQKLK
SEEGSMRLSAERSRLDRSLNTAEQELQEAQQQILMLQQTQLADMEHSHSLCESLVQQRDE
VQREAEKMRSSLRDAERTLGTRERAHRHRVKGLEEQVSTLKEQLQQEIKRRQPSLPASLL
SK
Download sequence
Identical sequences ENSPFOP00000018221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]