SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000018946 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000018946
Domain Number 1 Region: 320-458
Classification Level Classification E-value
Superfamily CBS-domain pair 0.000000000000392
Family CBS-domain pair 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000018946
Domain Number - Region: 557-608,639-667
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000138
Family cAMP-binding domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000018946   Gene: ENSPFOG00000018829   Transcript: ENSPFOT00000018968
Sequence length 714
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519901.1:647600:661359:-1 gene:ENSPFOG00000018829 transcript:ENSPFOT00000018968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNMVASLAGLRFLLMILLFCGIRFGACSQEAPQVVGLRLEDPGGLVRMKDRIISAPEGAT
FQLRLFGANLNGSWPWPWLAFAGAAEGAAGSRGGMWASVGPDRLQVCPGESTVPPRLDMT
PTTAPPRLNMTKTAVPPWGLALLVVLMLLICGLLRTVNLSLLWLDPVELYVLHSCGSEEE
KRAAKRLEPIRRRGNFLTCSLLFLCVLGHSVIGVLLYRALGSIVSAVFTSGFLIFFLAEL
VPHVLCSGYGFQLAPGLTWLAQVCMVLTCPLSCPLGLILDLGLGRDISTCGIRERAMEMI
RASVNDPYSEFVKEEFSRGMLRTKTVEDILTPLKDCFMLPSSAVLDFSTMSEIMQSGYTR
VPIYEEESRSNIVEILYVKDLALVDPEDCTPMTTITKFYNHPLHFVFNDTKLDAMLEEFK
KGNSHMAIVQKVNNEGEGDPFYEVLGLVTLEDVIEEVIKSEILDESDGYLDRKVKRPMTP
LEIPLEPRGSHEEFSLFKPPEGEPKIHTSPQLLLATHRFLSREVEHFSPARVSEKVLFHL
LRHPSVNQEVHFDHNNRLSPSHYLYTRNHPVDYFILLLQGRVEVEIGKEGLKFENGAFTY
YGVSALTLPSSAVHQSPVSTQRHSPRDPFESADTTSPSSYCPDYTVRALTDLQLIRVTRL
QYLNALMASRAGHSPDPPEIKILPNSQTKLLNDRNATPGSSRAQESSTEEEAHG
Download sequence
Identical sequences ENSPFOP00000018946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]