SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspfo1|48306|fgenesh1_kg.9_#_185_#_Locus12211v1rpkm1.58 from Aspergillus acidus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspfo1|48306|fgenesh1_kg.9_#_185_#_Locus12211v1rpkm1.58
Domain Number 1 Region: 115-478
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.86e-89
Family Glutamine synthetase catalytic domain 0.0000521
Further Details:      
 
Weak hits

Sequence:  jgi|Aspfo1|48306|fgenesh1_kg.9_#_185_#_Locus12211v1rpkm1.58
Domain Number - Region: 20-101
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.000144
Family Glutamine synthetase, N-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspfo1|48306|fgenesh1_kg.9_#_185_#_Locus12211v1rpkm1.58
Sequence length 480
Sequence
MATTITAEDLPNLLANDIKVKVAGVDCDGILRGKVMSKEKFLGIAQKGFGFSSAVFGWDM
QDVLYTTEANIAPADSGYVDFLAVPDLNSFRRIPWEDDIPFFLVRFVQNDKPVSADGRSM
LRSICDKLAANNCKGMAGVELEFMNFQTPSEDGYGANGSQTRDIAAFLDKNAPGALRPLT
AGSFSYSATRPVAYKKYFYDIFDTSARFNCGIEGWHTEGGPGVYEAALKVCDVSDMADKV
SLFKLLAKSIGVEHGITPCFMAKPMQGQPGSSGHIHVSLTDLEGKNLFARDTPDPNAPWA
DAAGLSDLGRQFLAGVLEALPDIMPLFAPTINSYKRLVENFWAPVNISWGLEDRMASVRI
ITPPVCKPGATRFEVRIPGADLHPHYALSVILAAGWRGVEKKLDIKVPPVNVQKAEKIKA
ELLPNTLEEALRRFNDKESVAREILDPEFVDFFTATREHELRVWREAVTDWEFKRYIETV
Download sequence
Identical sequences A0A1M3TC18
jgi|Aspfo1|48306|fgenesh1_kg.9_#_185_#_Locus12211v1rpkm1.58

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]