SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspfo1|207802|gm1.6426_g from Aspergillus acidus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspfo1|207802|gm1.6426_g
Domain Number 1 Region: 988-1211
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-43
Family DBL homology domain (DH-domain) 0.00096
Further Details:      
 
Domain Number 2 Region: 1223-1305,1365-1401
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000938
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspfo1|207802|gm1.6426_g
Sequence length 1836
Sequence
MAHYQNGYPSYNQPPGSPPNPTQHNRYDLYPTQPTSPQLRRMPSYNVGDDAGLLGSPNSQ
NARSTEVNARYPGWNAQAEGQSSYNVMNTGRDDYADPRYAHVPAPTSPQLSRARASSQSS
YQYQYTSSVPAATSPTQHAYNPQQYALPPTPSQQQVGFSPLAYTGPSTSYSSATATGHQP
YNPAAYQPASFVASPVQRQPTSAFAHAPPTPQTWGPPHPQLPPPPPPRGPDHPYGSRPSP
QYGNASPGMQYGFTTQQASSSTTLSSGSLSYGTASPSTTSATYISANSSSTAGSANVASH
PYAGGAQVPNYLPQSPPHPGDVITSFDEQPPAPPAHSTPTEEAFGKRLSLTRPGSGRSLP
TPPIHPSQTQMSPRRTDTLTRHPQSRPLPGPPIDADVDSEPYMAANGHGSRDSRPSTRPG
YDELMQQDDAAVADRRTAGESGYSLDPSHVNPHSALVLEPSNSESAGPRLSPDERHTHTN
GSIATGTGQYVNYDAYSDDSDAEAAAGLAMLQMADEEDKAQAERLQDRARRETTASIISA
YGSRSENRVPSPQQDWQQDELGSYGESYRRASQYDEGDHYANGHNDDDGHPRLAPSSGSM
RGSNPFGDGHEEYSDDYDYPPTALDESGYPYNDMQHHARVDAGGTGGLSEPGAYGRRMSF
DYGDETDGPFSENNGLQHSGSESSGRGEEPGDLFFHPGMRPLPPAPVEPASNPNLMSHLM
PAGTYRHHEQGDGRGSTQYTSSQFPVAPDSYASSTVSSPTQVPRSTSLSSHPIGPRTDPP
IRSKTDADRAKYKQQQELLRQQQYGALKLDVSPDAAAAMTLDLPTIPAGRRKKFNPTKLS
SEQFRRCTEPWALSSILAWIRELSEDETDLKEHAIVEAIVALFTHKVPTMNMADAETLAA
RVVKNMLAEGALVKDEEWVKFGTGTLSGVLFQITGTGCYSSRLHEQEAEVFGRCYSHHCM
RTLKKVNLKAQMMEPEKKAEDWVTFYKVPKEVWETHSKKEIDRQNNLHEIVTTEDSYISQ
LDVLRELYRDQLANMQPSVIAPKRLNRFLNDVFGKVDAVKKVNEDHLLAQLKYRQKEQGP
FIAGFSDIFREWIRKAKTAYVDYAATFPNANYVVRKEAERNVHFRQFLSQVRDHKLSNRL
SWDTYLKAPITRIQRYTLLLSTVHKNMVKDSEEKTNLAQAIDEIKMVALECDHKVGEMSR
KVDLMELSTKLQLRPEMKKDVELNLEHLGREIVFRGDLQRPGTRTRFLVDTHAILFDHYL
VLAKAFTAKDTSRSVKYESYDVSKLPIPMDLLVLESTNDDPVVKSAVRGVVAQSPAAVAG
RGAAGGPLTHTASGNSGSSGNSNGGRALVPATVLESSKDDKILYPFKVKHLGKAGTYTLY
AFSAQNRQDWCDKITEAKTKHAAALFAQNAEPFRLRVLADTAFGTSDNSYIPTGVIIDGT
PLDRAIKDVEERYHGSPRPAPVCRTGVHCATVFQQPPGRMRCAIGTDYGVYVSDYNDPRG
WTRVIPIVRVTQIAVFEEFNVFLLIADKSLIAYHLDVVCPPSGVAAQATTDSSRRAPQKL
SGSREVGFFAAGHMKDRTLVMYKKRDGLSSTFKILEPVAQKSSSSRSRLFSRRSQTEFFR
EYDEFYIPAESYGMNLFHSSLAISTQRGIEILTIDKKHTWSVPDFRSEAPPEAQAHLSSI
AQRIGALRPLGMFRLSDSEFLVVYTECAVYVNKHGDVSRSVVMEFVGHAHSACLYGRFLI
LFNDDFVEVRNAMNGRLRQVIPGHGVVCLDDGSHMPGSGANSIPTSTGGAVNLSSGLSNG
ASLANNGRTVKICMQHPEYERSQLILELIENEGQKD
Download sequence
Identical sequences A0A1M3TGY7
jgi|Aspfo1|207802|gm1.6426_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]