SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspfo1|216642|estExt_Genemark1.C_3_t30082 from Aspergillus acidus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspfo1|216642|estExt_Genemark1.C_3_t30082
Domain Number 1 Region: 754-1384
Classification Level Classification E-value
Superfamily Molybdenum cofactor-binding domain 1.44e-182
Family Molybdenum cofactor-binding domain 0.0000000000174
Further Details:      
 
Domain Number 2 Region: 264-477
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 8.18e-48
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0000718
Further Details:      
 
Domain Number 3 Region: 606-752
Classification Level Classification E-value
Superfamily CO dehydrogenase molybdoprotein N-domain-like 8.24e-36
Family CO dehydrogenase molybdoprotein N-domain-like 0.0002
Further Details:      
 
Domain Number 4 Region: 485-597
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 6.28e-32
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.00023
Further Details:      
 
Domain Number 5 Region: 111-187
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 6.02e-28
Family CO dehydrogenase ISP C-domain like 0.0001
Further Details:      
 
Domain Number 6 Region: 20-105
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 6.51e-19
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspfo1|216642|estExt_Genemark1.C_3_t30082
Sequence length 1404
Sequence
MVLPTALQDFLTTAASTPNLSFYLNGTPIVLANPNPHWTLLDFIRSQHGLKGTKLGCGEG
GCGACTVVLQTRDGRAQIRHRAVNACLYPLIGVAGKHVITVEGLGNVDHPHPLQERLGKL
HGSQCGFCTPGIVMSLYALVRNAYDPKTGQFNLTEDDIEMKGHLDGNLCRCTGYKPILQA
AKTFVQEDLQARLAVRTRPSDMETPIESESDTSRPQSCGRPGGCCRDTPGSSCSSSSDRD
SSRTSISTPDTEPEKDLANNTVPQFDFKPYIPNTELIYPPALTKATPQLVCYTDDRKAWL
RPVTLAQTLDILARCPSATLVGGASEVQVDIRFKGAEFAVSVFVGDLDELSYIRPVEKDG
TITELIIGGNTPLSDIEAECNRLIPDLGDRASVLSATSKVLRYFAGRQIRNAASLAGNIA
TASPISDMNPVLLAINATIVARTPTQETTIPMTNMFLGYRKTALPKDSIITSICIPLPPP
GTREITKSYKQAKRKDDDIAIVTAAFRVRLAPDNTVSEIALAYGGMAPTTLLARQAMAAL
QGKKWGVQAVLDSTLDALLVDFNLPYSVPGGMAHYRRTLATSLFFRFWHEVVADLNLTST
AADPSITTEIHRNISHGTRDNHNPHEQRVVGKQLPHLSGLKHATGEAEYVDDMPPQHREL
FGAMVLSQRAHAKLLSVDWTPALQPGLALGYIDHTSIPAEKNIWGPVVKNEQFFAVDEVT
AHGQPIGLVYAETALQAQMAARAVKVEYEDLETILTIDEAIEKGSYWPHGKQLRKGVAVT
PEKMKDVFDKCDRVFEGVIRMGGQEHFYLETNAAVVIPHSEDGSMEVWSSTQNTMETQEY
VSQVTSVPASRINARVKRMGGAFGGKESRSVQLACLLAIAAKKTKRPMRAMLNRDEDMIT
SGQRHPFQCRWKVGVMNDGKLVALDADVYNNAGFSLDMSGAVMDRCCTHIENCYYFPHAH
IRGWVCKTNTHSNTAFRGFGGPQAMFIAESYMSAVAEGLGMDIDELRMKNLYTQGQRTPF
LQEIDQDWHVPMLLEQVKKEARYAERKAEIAEFNKRHRYRKRGISMIPTKFGISFATAVH
LNQAGANVKIYTDGSVLLNHGGTEMGQGLYTKMVQVAAQELGVPAESVYTQDSSSYQTAN
ASPTAASSGSDLNGMAVKDACDQLNERLKPYREKFGKDADMATMAHAAYRDRVNLAASGF
WKMPKVGYQWGTYDVEKVKPMYYYFTQGVACTEVELDLLTGDHTVLRTDIKMDVGRSINP
AIDYGQIEGAFVQGQGLFTMEETLWTQGGQLATRGPGTYKIPGFSDIPQEFNVSFLQGVS
WSHLRSIQSSKGIGEPPLFMGSSVLFALREALKSARADFGVQGPLVLDSPATAEKLRLAV
GDDLVKKAEVKRKEGEKGFFVAVA
Download sequence
Identical sequences A0A1M3TT34
jgi|Aspfo1|216642|estExt_Genemark1.C_3_t30082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]