SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75812379|ref|YP_319998.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|75812379|ref|YP_319998.1|
Domain Number - Region: 50-73
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.00188
Family Intron-encoded homing endonucleases 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75812379|ref|YP_319998.1|
Sequence length 102
Comment HNH endonuclease [Anabaena variabilis ATCC 29413]
Sequence
MSQDLYPNNWKEIATALKAASNWRCAKCGRVCLRPGEKPDNLTFSERKAHTLQVHHWNRD
PSDNRLENLVCLCSGCHLSYHCFSRGNVSPGQLSLFAEQKVS
Download sequence
Identical sequences A0A1W5CEY3 Q3M2H7
gi|75812379|ref|YP_319998.1| 240292.Ava_B0097 gi|75812379|ref|YP_319998.1|NC_007410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]