SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75812425|ref|YP_320044.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75812425|ref|YP_320044.1|
Domain Number 1 Region: 38-82
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.000000128
Family Deoxyhypusine synthase, DHS 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75812425|ref|YP_320044.1|
Sequence length 102
Comment hypothetical protein Ava_B0143 [Anabaena variabilis ATCC 29413]
Sequence
MMLTPIVRNVYKVWLRELSVKSRLNRTVLLSLVDARVCTKYTIQVTVANERDEALSGSTL
KEIHSWGKVNITTEQIVFSEMSFEMVKSVYPKRFNWPRCVSP
Download sequence
Identical sequences Q3M2D1
gi|75812425|ref|YP_320044.1|NC_007410 gi|75812425|ref|YP_320044.1| 240292.Ava_B0143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]